KEGG   Glaciecola nitratireducens: GNIT_3073Help
Entry
GNIT_3073         CDS       T01632                                 

Gene name
folM
Definition
alternative dihydrofolate reductase (EC:1.1.-.-)
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
gni  Glaciecola nitratireducens
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gni00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:gni00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3415502..3416215
Genome map
AA seq 237 aa AA seqDB search
MTSPILITGGAQRLGLAIAKDLIAQQHEVIITYRTKKPAVDELKALGAVVIQADFATQDG
ITTLISDVKSQTKTLRAVIHNASDWDQEADTNDYNQLFQKMMQVHANTPYQLNLALQNML
ASNDVVSDIIHMTDYVQIKGSKKHIAYAASKAALHNLTLSFSALLAPKVKVKVNSIAPAL
VMFNDHDSPIYRAKALKKSLLEVCPGPQEAVKAVNYLLSSDYVTGQTLHLDGGRHLK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgacttcccccatactcattacaggaggcgcccaacgccttggcttggcaattgcaaaa
gacttaatagctcagcaacacgaagtaattataacatacagaactaaaaagcccgcagta
gatgaattaaaagcgctaggtgcggtggtaatccaagctgacttcgcaacgcaagatggt
ataacaacgctaatttcggacgtaaaaagtcaaaccaaaaccttacgtgctgttatacac
aatgcctcagactgggatcaggaggccgatacgaatgactataaccagttgtttcaaaag
atgatgcaggtgcacgcaaatacaccttaccaactgaatttagcgttgcaaaatatgctg
gcttctaatgatgttgtcagtgacattattcacatgaccgactacgtacaaataaaaggc
agcaaaaagcacatcgcttatgccgctagtaaagcagctttgcacaatttaacactgtca
ttcagtgcactactagcaccaaaggtaaaggtaaaggtaaacagcattgcaccggcacta
gtgatgttcaacgatcatgattcccccatctaccgcgcaaaagccctaaaaaaatcgctg
cttgaagtatgtccaggtccgcaagaagcggtaaaagcggttaattatttgctgagtagc
gattatgtcaccggtcaaacattgcacctagacggtggtcgccatttaaagtag

DBGET integrated database retrieval system