KEGG   Glaciecola nitratireducens: GNIT_3482Help
Entry
GNIT_3482         CDS       T01632                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
gni  Glaciecola nitratireducens
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    GNIT_3482 (cysQ)
Enzymes [BR:gni01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     GNIT_3482 (cysQ)
Transfer RNA biogenesis [BR:gni03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    GNIT_3482 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3904951..3905766
Genome map
AA seq 271 aa AA seqDB search
MHHSIAELLEIAKEAACTAGQEVLDIYDKGVFEEYAKDDESPVTSADYRANDIIMSILQE
QTPDIPVMSEETPQVPLEERAKWTRYWLIDPIDGTQEFIARSGDFAVNIALIENNEPVIG
VIYWPTGETLYFASKDQGAYKRCNVETKRIAVREFKVPSEDVIMIAISRRQSREKVFNKM
SDKRVYQTLPAGSCSLKACFIAEGKADVFMRLGVTGEWDTGASQCIINEAGGRIVAATFD
ELSYNQRDSVENPDFVVLGDQRVHWESVIQY
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccattccattgcagagttactagaaatagctaaagaagccgcctgtactgcagga
caagaagtcttagatatctacgacaaaggcgttttcgaagaatacgcaaaagatgacgaa
tcgccagtcaccagcgcagactaccgagcgaacgatatcattatgagcatcttgcaagag
cagacgcctgatattccagtgatgtctgaagaaacaccgcaagtgcctcttgaggagcgc
gcaaaatggacccgttattggcttatagatcctattgacggcacgcaagagtttattgcg
cgctcaggtgattttgctgtcaacattgcactgattgagaataatgaacccgttattggg
gttatttattggcccaccggtgaaacgctgtattttgcaagtaaagaccaaggtgcatat
aaacgctgcaatgttgaaaccaaaagaatcgcggtgagagagttcaaagtacctagcgaa
gacgtgatcatgattgcaattagtcgtcgacaatcgcgtgaaaaagtgttcaataaaatg
tcagataaacgcgtgtaccaaacgctaccggcgggcagttgctcgttaaaagcctgtttc
attgccgaaggtaaggctgacgtattcatgcgtttaggtgttacgggtgaatgggatact
ggtgcctctcaatgcattattaacgaagccggcggcagaattgtcgccgccacatttgat
gaactcagctataaccagcgcgattcagttgaaaacccagatttcgtggtactaggtgat
cagcgcgtacattgggaaagcgtcattcagtattaa

DBGET integrated database retrieval system