KEGG   Geodermatophilus obscurus: Gobs_0214Help
Entry
Gobs_0214         CDS       T01163                                 

Definition
DNA-formamidopyrimidine glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
gob  Geodermatophilus obscurus
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:gob03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
223881..224735
Genome map
AA seq 284 aa AA seqDB search
MPELPEVEALTAFLREHAVGSVVTRVDLAAVQAIKTFDPPLSALGGLELTGVARHGKFLD
LDVSGLHLVVHLARAGWLHWRTGLPTAPPKPGKGPLAVRVHLEDGDGFDLTEQGTRKGLA
VYVVRSPAEVPGIARLGPDALAVDRDTFVALLAGRSGQLKGALTDQTLLAGIGNAYSDEI
LHAARLSPFKMADKLSDDEALRLYDAMRATLTEALQRQVGQEAATMKGEKRSGLQVHART
GLPCPVCGDTVREVSFADTSLQYCPTCQTGGKPLADRRMSKLLR
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagttgcccgaggtggaggcgctgaccgcgttcctgcgtgagcacgcggtcggc
tccgtggtgacccgcgtcgacctggccgccgtccaggcgatcaagaccttcgacccgccg
ctgtcggcgctcggggggctggagctcaccggcgtcgcccggcacgggaagttcctcgac
ctcgacgtctccggcctgcacctcgtcgtccacctggcccgggccggctggctgcactgg
cgcaccgggctgccgaccgctccgccgaagccgggcaaggggccgctcgcggtccgcgtc
cacctcgaggacggcgacggcttcgacctcaccgagcagggcacccgcaaggggctggcg
gtctacgtcgtccgttcgccggccgaggtgccgggcatcgcgcggctggggcccgacgcc
ctcgccgtcgaccgggacaccttcgtcgcgctgctggccgggcgcagcgggcagctcaag
ggcgcgctcaccgaccagacgctgctggccggcatcggcaacgcctactccgacgagatc
ctgcacgccgcgcggctctcgccgttcaagatggccgacaagctcagcgacgacgaggcc
ctgcgcctctacgacgcgatgcgggcgaccctcaccgaggcgctccagcgccaggtcggg
caggaggcggccacgatgaagggcgagaagcgctcggggctgcaggtgcacgcccggacc
ggtctgccgtgcccggtgtgcggcgacaccgtccgcgaggtcagcttcgccgacacctcg
ctgcagtactgcccgacctgtcagaccggcggcaagccgctggccgaccggcggatgtcc
aagctgctgcgctga

DBGET integrated database retrieval system