KEGG   Geodermatophilus obscurus: Gobs_0479Help
Entry
Gobs_0479         CDS       T01163                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
gob  Geodermatophilus obscurus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gob00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Gobs_0479
DNA repair and recombination proteins [BR:gob03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Gobs_0479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
523808..524407
Genome map
AA seq 199 aa AA seqDB search
MYEGAVQDLIDELGRLPGVGPKSAQRIAFHLLAAESADVGRLVAALQRVQAEVRFCSTCY
NVAEGEQCRICRDPRRADDVICVVEEPKDVVAIERTREFRGRYHVLGGAISPIEGVGPDD
LRVKELMTRLMSGAVTELIIATDPNLEGEATAAYLARLVGPLGLAVSRLASGLPVGGDLE
YADEVTLGRAFEGRRRIDA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgagggggccgtccaggacctcatcgacgagctcggccggctgcccggcgtcggg
ccgaagagcgcccagcgcatcgccttccacctgctggcggcggagtccgcggacgtcggc
cggctggtcgcggcgctgcagcgcgtgcaggccgaggtccgcttctgcagcacctgctac
aacgtcgccgagggcgagcagtgccgtatctgccgcgacccgcggcgggccgacgacgtc
atctgcgtcgtcgaggagcccaaggacgtcgtcgcgatcgagcgcacccgcgagttccgc
ggccgctaccacgtgctcggcggcgcgatcagcccgatcgagggcgtcggccccgacgac
ctgcgggtcaaggagctgatgacccggctgatgagcggtgcggtcaccgaactgatcatc
gccaccgaccccaacctcgagggcgaggccaccgcggcctacctggcgcggctggtcggc
ccgctcgggctggccgtctcccggctggccagcggactcccggtgggcggcgacctagag
tacgccgacgaggtcacgctgggccgggcgttcgagggccgccgccgcatcgacgcctga

DBGET integrated database retrieval system