KEGG   Geodermatophilus obscurus: Gobs_0546Help
Entry
Gobs_0546         CDS       T01163                                 

Definition
cobaltochelatase subunit (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
gob  Geodermatophilus obscurus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Gobs_0546
Enzymes [BR:gob01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Gobs_0546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(592275..594299)
Genome map
AA seq 674 aa AA seqDB search
MTYPFGAVVGMDDMRLALLLNAVSPAVGGVLVRGEKGTAKSTTVRALSAVLPPVDVVAGC
RFACDPAAPDPACPDGPHDAGAPGSTRPARLVELPVGASEDRVVGSLDLERALTEGVKAF
EPGLLAAAHRGVLYVDEVNLLHDHLVDLLLDAAALGTAYVEREGVSVRHAARFLLVGTMN
PEEGELRPQLLDRFGLTVEVAAPRDPVERAEVVRRRFAHDADPAGFAASWADEEAGLARR
IAEARARLPHVVLSDDALRQVTAVCAAFDVDGLRADLVTARAAIAHAAWCGRDEVTEDDV
RVAARLALPHRRRRNPFDAPGLDEETLEQALDDARPDDDPPEGPDDGGGTPPPPPLGPSG
DGGAPEAPGADDGTGSSPPSTAPRGEGGGSAEAAPAPDRAAVAPGDPFRTRRLEVPGIGA
GVAGRRSRARGDRGRVVGATRPSGTVTRLHLTGTVLAAAPHQVARGRTGPGLRIAREDLR
QAVLEGREGNLVLFVVDASGSMGSRSRMTAVKGAVLSLLLDAYQRRDKVGLVTFRGAEAE
LALPPTWSVEAAAARLTALPTGGRTPLAAGLLRAHETLRVERVRDAQRRPLLVVVTDGRA
TGARGSAAVADAHAAAALLAAQGTAAVVVDCESGPVRLGLAGALGTALGAQTLRLEELAA
ESLAATVRSLREVA
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgacgtaccccttcggcgccgtcgtcggcatggacgacatgcggctcgccctgctgctc
aacgccgtctcccccgccgtcggcggcgtgctcgtccgcggcgagaagggaacggcgaag
tcgacgacggtgcgcgcgctgtccgccgtgctgcccccggtggacgtcgtcgccgggtgc
cgcttcgcctgcgaccccgccgccccggacccggcctgccccgacggcccgcacgacgcc
ggcgccccgggctccacccgcccggcgcggctggtcgagctgccggtgggcgcctcggag
gaccgcgtcgtcggctcgctggacctcgagcgggcgctcaccgagggcgtgaaggccttc
gagcccgggctgctggccgcggcgcaccgcggcgtgctctacgtcgacgaggtcaacctg
ctgcacgaccacctcgtcgacctgctgctggacgccgccgcgctgggcaccgcctacgtc
gagcgcgagggcgtctcggtgcggcacgctgcgcggttcctgctggtcgggacgatgaac
cccgaggagggcgagctgcgcccgcagctgctcgaccgcttcgggctcaccgtggaggtg
gccgcgccgcgcgacccggtcgagcgcgccgaggtggtgcgccgccggttcgcccacgac
gccgacccggccgggttcgctgcgtcgtgggccgacgaggaggccgggctggcgcgccgg
atcgccgaggcccgcgcccgcctgccgcacgtcgtcctctccgacgacgcgctgcgccag
gtgaccgccgtgtgcgcggcgttcgacgtcgacgggctgcgcgcagacctggtcaccgcc
cgcgccgcgatcgcgcacgccgcctggtgcggccgggacgaggtcaccgaggacgacgtc
cgggtggccgcccggctggccctcccgcaccgccggcgccgcaacccgttcgacgcgccc
ggtctggacgaggagaccctcgagcaggcgctcgacgacgcccgccccgacgacgacccg
cccgagggcccggacgacggcggcggcaccccgcctcccccgccgctcggcccgtctggg
gacggcggtgcgccggaggccccgggcgccgacgacggcaccgggtcgtcccctccctcg
acggcaccccgcggggagggtggcggctccgccgaggccgccccggcccccgaccgcgcc
gcggtggcgcccggcgacccgttccgcacccgccgcctcgaggtgcccggcatcggcgcg
ggcgtggccggccggcgctcgcgggcacgaggcgaccgcggccgcgtcgtcggcgcgacc
cgcccgagcggcacggtcacccggctgcacctgaccggcaccgtgctcgccgccgcgccg
caccaggtcgcccgcggccgcaccggcccgggactgcggatcgcccgggaggacctgcgc
caggccgtcctggagggccgggagggcaacctcgtgctcttcgtcgtcgacgccagcggc
tcgatgggctcccgctcgcggatgaccgcggtcaagggcgccgtgctctcgctgctgctc
gacgcctaccaacggcgggacaaggtcggcctggtcaccttccgcggcgccgaggccgag
ctggcgctgccgccgacctggtcggtggaggccgccgcggcccggctcaccgcgctgccc
accggcgggcgcaccccgctcgccgccgggctgctgcgagcgcacgagacgctgcgggtc
gagcgggtccgcgacgcgcagcgccgcccgctgctcgtcgtcgtcaccgacgggcgggcc
accggtgcgcgcgggtccgccgccgtcgccgacgcgcacgccgccgcagcactgctggcg
gcgcaggggacggcggccgtcgtcgtcgactgcgagtccggcccggtgcgcctcgggctg
gccggcgcgctcgggacggcgctgggcgcgcagaccctgcgcctggaggagctggccgcc
gagtcgctggccgccacggtgcgctcgctgcgggaggtcgcctag

DBGET integrated database retrieval system