KEGG   Geodermatophilus obscurus: Gobs_0620Help
Entry
Gobs_0620         CDS       T01163                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
gob  Geodermatophilus obscurus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gob00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
661992..662498
Genome map
AA seq 168 aa AA seqDB search
MTRAVLSLGANLGDRAAALRTAVTTLKDDGVLVARSTLYEAPPWGPVEQPPYLNAVVVVR
GDRDAAGWLARAHELEQAAGRSRDVRWGPRTLDVDVVTATGDDGQPVLSDDPALTLPHPR
AHERAFVLVPWASLDPTAVLPGRGRVSDLLAALPPEDVAAVVRWEHLR
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgtgcggtcctgtcgctgggcgccaacctgggggaccgtgccgccgcgctgcgc
accgccgtcaccacgctcaaggacgacggcgtgctcgtggcccgctcgacgctgtacgag
gcaccgccgtgggggccggtcgagcagccgccgtacctcaacgcggtggtcgtcgtccgc
ggcgaccgggacgccgccggctggctggcccgtgcgcacgagctggagcaggccgccggg
cgcagccgcgacgtgcgctggggaccgcgcaccctcgacgtcgacgtcgtcacggccacc
ggggacgacgggcagccggtcctctccgacgaccccgcgctcaccctcccgcacccccgc
gcgcacgagcgcgcgttcgtgctcgttccgtgggccagcctcgaccccaccgcggtgctg
ccgggccgcggccgggtgagcgacctgctggccgcgctgccaccggaggacgtcgcggcc
gtcgtccgctgggagcacctccggtga

DBGET integrated database retrieval system