KEGG   Geodermatophilus obscurus: Gobs_0781Help
Entry
Gobs_0781         CDS       T01163                                 

Definition
(GenBank) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gob  Geodermatophilus obscurus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Gobs_0781
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gobs_0781
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Gobs_0781
Enzymes [BR:gob01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Gobs_0781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
829638..830957
Genome map
AA seq 439 aa AA seqDB search
MTLTAPGSTETSPALQADSSAGGPVAPSPARGLVCRNCGATFGLIAEHACAECFGPLEVD
YDPELMRAVSRELIESGPQNIWRYAALLPVGQDPADRVTLDPGMTPLVRADRLAAELGLT
GGLWVKDDSANPTHSFKDRVVSLAATAAKRLGYSKIAAASTGNLANSVAAHAARVGLPSF
VFIPSDLEPGKVVQSAVYGQTLVAVDGSYDDVNRLTSELAETDEFEDTAFVNQNVRPYYA
EGSKTMGYEIAEQLGWRIPAQVVIPMASGSLLTKVDKAFRELVAAGIVEATEWRIFGAQS
AGCDPIATAFDNGWDVVKPVKPTGIAKSLNIGNPADGPYALDAIRRTGGAVGRVDDAQIV
QGIRDLARTTGVFAETAGGVTTAVLRQLVEDGRLDPAEETVILNTGEGLKTLDPLEPVVG
PTHRVSPSLSSVRAAGLIG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgaccgctcccggctccaccgagaccagcccggctctgcaggccgactccagc
gcgggcggccccgttgcgccgtccccggcccgcgggctggtctgtcgcaactgcggcgcc
accttcggcctgatcgccgagcacgcctgcgccgagtgcttcggcccgctggaggtcgac
tacgaccccgagctgatgcgggcggtcagccgcgagctgatcgagtccggcccgcagaac
atctggcgctacgctgcgctgctcccggtgggtcaggacccggccgaccgcgtcaccctc
gacccgggcatgacgccgctggtgcgcgccgaccgcttggccgccgagctcggcctcacc
ggcgggctgtgggtcaaggacgactcggccaaccccacgcactcgttcaaggaccgcgtg
gtcagcctcgccgccaccgcggccaagcggctgggctacagcaagatcgccgccgcctcg
accggcaacctggccaactcggtggccgcgcacgccgcccgcgtcggcctgccctccttc
gtcttcatcccctcggacctcgagcccggcaaggtcgtacagtccgcggtctacgggcag
acgctggtcgccgtcgacggctcctacgacgacgtcaaccggctgaccagcgagctcgcc
gagaccgacgagttcgaggacaccgccttcgtcaaccagaacgtgcggccctactacgcc
gagggctccaagacgatgggctacgagatcgccgagcagctcggctggcggatcccggcc
caggtcgtcatcccgatggcctcgggctcgctgctcaccaaggtggacaaggcgttccgc
gagctggtcgcggccggcatcgtcgaggccaccgagtggcgcatcttcggcgcccagtcg
gccggctgcgacccgatcgccaccgccttcgacaacggctgggacgtcgtcaagccggtg
aagccgaccggcatcgccaagtcgctgaacatcggcaaccccgcagacgggccgtacgcc
ctcgacgcgatccggcgcaccggcggtgccgtcggccgggtggacgacgcccagatcgtg
cagggtatccgcgacctggcccgcaccaccggtgtcttcgccgagaccgccggcggcgtc
accaccgcggtgctgcgccagctggtcgaggacggccggctggacccggcggaggagacc
gtcatcctgaacaccggggagggcttgaagaccctcgacccgctggagccggtcgtcggg
ccgacccaccgggtgtcgccgtcgctgtcgtcggtccgggcggccggtctcatcgggtga

DBGET integrated database retrieval system