KEGG   Geodermatophilus obscurus: Gobs_0884Help
Entry
Gobs_0884         CDS       T01163                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gob  Geodermatophilus obscurus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Gobs_0884
   00052 Galactose metabolism
    Gobs_0884
   00500 Starch and sucrose metabolism
    Gobs_0884
   00520 Amino sugar and nucleotide sugar metabolism
    Gobs_0884
Enzymes [BR:gob01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Gobs_0884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
936521..937435
Genome map
AA seq 304 aa AA seqDB search
MPTPSTRPTRKAVIPVAGMGTRFLPATKAVPKELLPVVDRPALQYIVEEAARAGLGEVLM
VTGRNKAAIEDFFDRHPELETALEKKGDAARLAAVHASTEIAQVHFVRQGEARGLGHAVL
QAAAFVGDEPFAVLLGDDIIDARDHLLEQMLQVQAEHGGSVVALLDVGRENIDKYGAVAV
EPGGTDVVAITGLVEKPPVDEAPSSLAIIGRYVLAPEVFDVLRETAPGRGGEIQLTDALA
TLVERGEPVHGVVFSGRRYDTGDRLDYLKAVVQLASEREDLGPGFRAWLAEFVADLPAAG
ASEA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgccgactccgagcacccgcccgacgcggaaggccgtcatccccgtcgccgggatgggg
acccgtttcctgccggccaccaaggcggtgcccaaggagctgctgccggtggtcgaccgg
cccgcgctccagtacatcgtcgaggaggccgcgcgcgccgggctcggcgaggtgctcatg
gtgaccggccgcaacaaggccgcgatcgaggacttcttcgatcgccaccccgagctcgag
accgcgctggagaagaagggcgacgccgcccggctggccgccgtgcacgcgtccaccgaa
atcgcccaggtgcacttcgtccgccagggcgaggcgcgcgggctcggccacgcggtgctg
caggccgccgccttcgtcggcgacgagccgttcgccgtcctgctcggcgacgacatcatc
gacgcccgcgaccacctgctcgagcagatgctgcaggtgcaggccgagcacggcggctcg
gtggtggcgctgctcgacgtcggccgggagaacatcgacaagtacggcgcggtcgccgtc
gagcccggtggcaccgacgtcgtcgcgatcaccggcctggtcgagaaaccgccggtcgac
gaggcgccgagcagcctggcgatcatcggccgctacgtgctggcccccgaggtcttcgac
gtcctgcgcgagaccgcgcccggccgcggcggcgagatccagctgaccgacgccctggcc
accctcgtcgagcgcggcgagccggtgcacggggtggtgttctcgggccgccgctacgac
accggcgaccggctggactacctcaaggccgtcgtccagctggccagcgagcgggaggac
ctcggccccggcttccgcgcctggctggccgagttcgtggccgacctgcccgccgcgggc
gcgtcggaggcctga

DBGET integrated database retrieval system