KEGG   Geodermatophilus obscurus: Gobs_1516Help
Entry
Gobs_1516         CDS       T01163                                 

Definition
glycoside hydrolase family protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
gob  Geodermatophilus obscurus
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Gobs_1516
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Gobs_1516
Enzymes [BR:gob01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Gobs_1516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1569551..1570996
Genome map
AA seq 481 aa AA seqDB search
MRARRSRVVTVAVGVALLVGAQVGGSDRGAVPPAEAATGPTLRWWLTTGPGEALLSPQRT
TAFGRDRTGTGAVTVGEEPGQEVVGVGAALTESSAVLLGGLPPAARHETLRQLFDPATGA
GISVLRVPLGASDFALDDHTYDDVPPGETDEDLSSFSIDPARRYVLPVLSEALAVNPAVR
VVLTPWSAPAWMKTSGTTHGGRLGPVREDVYADYLVRAVADLRAAGAPVVALTLANEPGH
EDAGYPSMLVDAGQQERLAIAVRARLDGAGLGDVDVLAHDHNWDDTATPVSLLTGPAADA
YAGAAFHCYGGDVSAQSAVAAAVPSTRIWTTECSGGTWSTSWSGDLRWGARHVLIGGFRN
SSAAVLWWNLALDPDGGPTNGGCTNCRGVLTVDPATGSVTPSVEYWLLSHAGRFVPRGSV
RLPTPERTAAGVESVAFRTPSGGHVLLLLNDAGEARRVPVRWAGRSAVLEVPAGGLVTAT
W
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcccgcaggtcgcgagtggtcacggtggcagtgggggtcgccctgctcgtcggc
gcgcaggtcgggggaagcgaccgcggcgccgtcccgcccgccgaagcagccaccgggcca
acgctgcggtggtggctcacgacgggccccggggaggccctcctctctccgcagcggacg
acggccttcggcagggaccgcaccggcaccggagcggtcacggtcggggaggagccggga
caggaggtcgtgggtgtgggggccgcgctgaccgagtcctccgccgtcctgctgggcggg
cttccccccgcggcacgccacgagacgctgcggcagctgttcgacccagcgaccggcgcc
gggatcagcgtgctccgcgtgccgctgggcgccagcgacttcgccctcgacgaccacacc
tacgacgacgtcccgccgggcgagaccgacgaggacctgagttcgttctccatcgacccg
gcgcggcgttacgtgctccccgtgctgtccgaagcgctcgccgtcaacccggccgtccgg
gtcgtcctcacgccgtggagtgcgccggcgtggatgaagacctcggggacgacgcacggc
gggcggctcggcccggtgcgcgaggacgtctacgccgactacctcgtgcgcgcggtcgcg
gacctccgcgccgccggcgcgccggtggtggcactgactctggccaacgagcccggacac
gaggacgccggctacccgagcatgctggtggacgctgggcagcaggagcgcctggcgatc
gccgtccgcgcccggctggacggagccgggctcggcgacgtcgacgtcctggcccacgac
cacaactgggacgacacggccacaccggtgtccctgctcaccggtccggcggccgatgcg
tacgccggagcggccttccactgctacggcggggacgtctccgcgcagtcggccgtggcg
gccgccgtaccgtccacccggatctggaccaccgagtgctcgggtgggacctggtcgacg
tcctggagcggggacctccggtggggagcccggcacgtcctgatcggcggcttccggaac
tcctcggcggcggtcctgtggtggaacctcgcgctcgacccggacggcgggcccaccaac
ggtggctgcacgaactgccgcggcgtcctcaccgtcgaccccgcgaccggcagcgtgacc
ccgtcggtggagtactggctgctgtcccacgccggccgcttcgtcccccgcgggtcggtg
cggctgcccacgcccgagcgcaccgcagccggggtcgagtcggtcgccttccgcaccccg
tccggtgggcacgtcctgctcctgctcaacgacgccggcgaggcgcggcgggtccccgtc
cgctgggccggccggtccgccgtcctggaggtgcctgcgggcggcctggtgaccgcgacc
tggtga

DBGET integrated database retrieval system