KEGG   Geodermatophilus obscurus: Gobs_1707Help
Entry
Gobs_1707         CDS       T01163                                 

Definition
pyridoxal-phosphate dependent TrpB-like enzyme
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gob  Geodermatophilus obscurus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gob01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:gob00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:gob00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1767234..1768589
Genome map
AA seq 451 aa AA seqDB search
MTSTDVPTTTSAMTKAVLDEADLPTHWYNLAADLPAPMPPHLHPGTGEPLAAGDMAPLFP
AALIEQEMTGERFVPIPEPVREVYRLWRPSPLYRAHRLERALGTPARIYYKYEGVSPVGS
HKPNTAVAQAYYNAAEGVRRLTTETGAGQWGSALSFASALFGLECEVWQVRASYDSKPYR
RMLMETFGGVVHASPSELTEAGRGFLERFPGTTGSLGMAVSEAVESAAPDPEARYALGSV
LNHVLLHQTVIGEEALRQLEVFGETAADVVYGCAGGGSNLAGLSFPFLREKLAGRTGTRV
VAVEPAACPSLTQGRYEYDHGDVAGLTPLMKMHTLGRDFVPEAIHAGGLRYHGMAPMVSH
VVDLGLITAQAVEQREAFDAGLLFARTEGLVPAPESCHAVAGAIAEARRRADTGETGVLV
VGLSGNGQLDLPAYAEHLTGVRTPATGDQPF
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgacgagcaccgacgtcccgaccaccacgtcggcgatgaccaaggccgtgctggacgag
gcggacctccccacgcactggtacaacctggccgccgacctgcccgcgccgatgccgccc
cacctgcacccggggaccggcgagcccctcgcggccggtgacatggcgccgctgttcccg
gcggcgttgatcgagcaggagatgaccggcgagcgtttcgtgccgatcccggaaccggtc
cgcgaggtctaccggctgtggcggccctcgccgctgtaccgggcgcaccgcctcgagcgg
gcgctggggacgccggcgcgcatctactacaagtacgagggtgtcagcccggtcggcagc
cacaagccgaacaccgccgtggcgcaggcgtactacaacgcggccgagggcgtgcgccgg
ctgaccaccgagaccggcgccgggcagtggggcagcgcgctgtcgttcgcctcggcgctc
ttcggcctggagtgcgaggtgtggcaggtccgggcctcctacgacagcaagccctaccgg
cggatgctgatggagaccttcggcggcgtggtccacgccagcccgtcggagctgaccgag
gccggccgcggcttcctggagcggttccccggcaccacgggcagcctcgggatggcggtc
agcgaggcggtggagtcggcggcgccggacccggaggcgcggtacgcgctgggcagcgtg
ctcaaccacgtgctgctgcaccagacggtgatcggcgaggaggcgttgcggcagctcgag
gtgttcggcgagacggcggccgacgtcgtctacgggtgtgccggtggcgggtcgaacctg
gcggggctgtccttcccgttcctgcgggagaagctggccgggcgcaccggcacgcgggtg
gtggccgtggaacccgccgcttgcccgtcgctcacgcaggggcgctacgagtacgaccac
ggcgacgtcgcagggctgaccccgctgatgaagatgcacaccctcgggcgcgacttcgtg
cccgaggccatccacgccggtgggctgcgctaccacggcatggccccgatggtcagccac
gtcgtggacctgggcctgatcaccgcccaggccgtcgagcagcgcgaggcgttcgacgcc
ggactgctgttcgcccgcaccgaggggctggtgccggcgccggagtcctgccacgccgtc
gccggcgcgatcgccgaggcccgccgccgcgcggacaccggggagaccggcgtcctggtg
gtgggcctgtccggcaacggccagctggacctgcccgcctacgccgagcacctcaccggc
gtgcgcaccccggcgacgggcgaccagcccttctga

DBGET integrated database retrieval system