KEGG   Geodermatophilus obscurus: Gobs_1728Help
Entry
Gobs_1728         CDS       T01163                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
gob  Geodermatophilus obscurus
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gob00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1794472..1795428)
Genome map
AA seq 318 aa AA seqDB search
MQEQTPIGPVDATRVPRYAGPATFARLPRIDEVSRADVAVLGVPFDSGVSYRPGARFGPG
HVRAGSKLLRSYNPALDATPFGTQQVADAGDIGVNPFDLGEAIETIDREVTTLRADGAQL
LTIGGDHTIALPILRSLARDHGPVAVLHFDAHLDTWDTYFGAPYTHGTPFRRASEEGLID
VERSLHMGIRGPLYSKQDLEDDAVLGFQVIRSDDYEIDGVRSIVERMRRRLTGGPVYVSV
DIDVLDPAHAPGTGTPEAGGLTSRELLNTLRGLVGLDVVGADIVEVSPPYDHAELTGIAA
AHVGYELLSVLALNRTGG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggagcagaccccgatcggcccggtggacgccacccgtgtcccccgctacgccgga
ccggccaccttcgcccggctgccgcggatcgacgaggtctcccgcgccgacgtcgccgtc
ctcggggtgcccttcgactccggggtcagctaccggcccggcgcccgcttcggccccggg
cacgtgcgggcgggctccaagctgctgcggtcctacaacccggcgctcgacgccacgccc
ttcggcacgcagcaggtggccgacgccggcgacatcggggtcaacccgttcgacctcggc
gaggcgatcgagaccatcgaccgcgaggtgaccacgctgcgcgccgacggcgcccagctg
ctcaccatcggcggggaccacacgatcgcgctgccgatcctgcgctcgctggcgcgtgac
cacggaccggtcgccgtcctgcacttcgacgcccacctcgacacctgggacacctacttc
ggcgccccctacacgcacggcacgccgttccgccgcgccagcgaggaggggctcatcgac
gtggagcgctcgctgcacatgggcatccgcggcccgctgtacagcaagcaggacctcgag
gacgacgccgtcctgggcttccaggtgatccgctccgacgactacgagatcgacggcgtg
cgcagcatcgtcgagcggatgcggcgccggctgaccggcggcccggtctacgtgtcggtc
gacatcgacgtcctcgaccccgcccacgcgccgggcaccgggacgccggaggccggtggc
ctcaccagccgggagctgctcaacacgctgcgcgggctggtcgggctggacgtcgtcggc
gccgacatcgtcgaggtgtccccgccctacgaccacgcggagctgaccggcatcgccgcg
gcccacgtgggctacgagctgctgtcggtcctcgcgctcaaccgcaccggcggctga

DBGET integrated database retrieval system