KEGG   Geodermatophilus obscurus: Gobs_1890Help
Entry
Gobs_1890         CDS       T01163                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00860  Porphyrin and chlorophyll metabolism
gob01100  Metabolic pathways
gob01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Gobs_1890
Enzymes [BR:gob01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Gobs_1890
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Gobs_1890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 Pyr_redox_2 Pyr_redox Thi4 HI0933_like Lycopene_cycl FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ADB74593
UniProt: D2SEC1
Position
1963673..1965037
Genome map
AA seq 454 aa AA seqDB search
MSRLVVVGAGITGLAAAFEWHRRRPDDEVVVLEAGDRIGGKLDRVQLAGHWYDTGPEAVL
ARVPEAVQLVERLGLADRLVAPATTQASVVLPDGRFPLPAGTVLGVPASTEGLDGVLTPG
GVARVAAEADLPPLALEGDVAVGALLRARLGDEVVDRLVEPLLGGVYAGRADELSLTATM
PQLAAHLPAAGSVLGAAAAARDAGARSRFDAGAPVFVTVADGIGSLPAALVAASGADVRL
RTPAHGLTRTATGFELSVGRANEPERLTADAVLVTAPAPKAARLLAGVAPGAVEPLLGIP
YASVAVVAMAFPAQDVDPGSGLLVPPVTGRLVKGVTVSSRKWPHLDGEHLMVRSSVGRFR
DERELQRDDDDLAAAVVADVADLLQLPRPEPVATRVVRWGGGLPQYLVGHQGRVDAVRAA
VSAVPGLAIAGAAFRGVGVPACIRDAHHAVDALL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagccggctggtcgtcgtcggcgccgggatcaccggactggccgcggcgttcgagtgg
caccggcgccgcccggacgacgaggtcgtcgtcctggaggcgggcgaccgcatcggcggc
aagctcgaccgcgtccagctggccgggcactggtacgacaccggccccgaggccgtgctc
gcgcgggtgcccgaggcggtgcagctggtcgagcggctcggtctggccgaccggctggtc
gcgccggccaccacgcaggcgtcggtggtgctgcccgacggccgcttcccgctgccggcc
ggcacggtgctcggcgtcccggcgtcgaccgaggggctcgacggcgtgctgaccccggga
ggtgtggcgcgggtggccgcggaggccgacctccccccgctggcgctggagggggacgtg
gccgtgggcgcgctgctgcgcgcgcggctgggcgacgaggtcgtcgaccggctggtcgag
ccgctgctcggcggcgtctacgccgggcgggccgacgagctgtcgctgaccgcgacgatg
ccgcagctggccgcgcacctgcccgccgccgggtcggtgctcggtgcggcggccgccgcc
cgcgacgccggggcgcgcagccgcttcgacgccggcgcgccggtgttcgtgaccgtcgcc
gacggcatcggctcgctgcccgccgcgctggtggccgcctcgggggccgacgtccggctg
cgcaccccggcacacggcctgactcggacggcgaccggcttcgagctctcggtcggccgg
gcgaacgagcccgagcggctgaccgcggacgccgtcctggtgaccgccccggcgccgaag
gccgcccggctgctggccggggtcgcgcccggggcggtcgagccgctgctgggcatcccg
tacgcgtccgtggccgtggtcgcgatggccttcccggcgcaggacgtcgaccccgggtcc
gggctgctggtgccgccggtgaccggtcggctggtcaagggcgtgaccgtctcctcgcgg
aagtggccgcacctggacggggagcacctgatggtgcgctcgtcggtgggccggttccgc
gacgagcgggagctccagcgcgacgacgacgacctcgccgcggccgtggtcgccgacgtc
gccgacctgctgcagctgccccggcccgagccggtcgccacccgcgtcgtccggtggggt
ggcgggctgccgcagtacctggtcggccaccaggggcgggtcgacgcggttcgtgccgcc
gtcagcgcggtgccggggctggcgatcgcgggcgcggcgttccgcggcgtcggcgtcccc
gcgtgcatccgcgacgcccaccacgcggtcgacgcgctgctctga

DBGET integrated database retrieval system