KEGG   Geodermatophilus obscurus: Gobs_2048Help
Entry
Gobs_2048         CDS       T01163                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00010  Glycolysis / Gluconeogenesis
gob00051  Fructose and mannose metabolism
gob00562  Inositol phosphate metabolism
gob01100  Metabolic pathways
gob01110  Biosynthesis of secondary metabolites
gob01120  Microbial metabolism in diverse environments
gob01130  Biosynthesis of antibiotics
gob01200  Carbon metabolism
gob01230  Biosynthesis of amino acids
Module
gob_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gob_M00002  Glycolysis, core module involving three-carbon compounds
gob_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gobs_2048
   00051 Fructose and mannose metabolism
    Gobs_2048
   00562 Inositol phosphate metabolism
    Gobs_2048
Enzymes [BR:gob01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Gobs_2048
Exosome [BR:gob04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Gobs_2048
  Exosomal proteins of bladder cancer cells
   Gobs_2048
  Exosomal proteins of melanoma cells
   Gobs_2048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADB74736
UniProt: D2SF46
Position
2128467..2129330
Genome map
AA seq 287 aa AA seqDB search
MARRGTPVRREGRRPLLAGNWKMNLTHLEAIGMVQKLAFSLKETELEAAEVVVLPPFTAL
RSVQTLVNGDKLEIGYGAQDLSVQDSGAYTGEVSGAMLAALACRYVVVGHSERRALHGED
DAVVAGKVQAALRHGLVPILCVGEGLEVRRAGEHVAHCTAQLDAALEGLTAEQLTGSGAG
TEAGGGGGSGSGGGVVIAYEPVWAIGTGEVATPEDAQEVCGALRSRLAERFGAETAGVVR
ILYGGSVKAANTAGILAGPDVDGALVGGASLDADEFAQICRTAADVG
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaggggcaccccggtccgccgcgaggggcgccggccgctcctcgccggcaac
tggaagatgaacctcacccacctcgaggccatcgggatggtgcagaaactcgccttcagc
ctcaaggagaccgagctggaggccgccgaggtcgtcgtcctcccgccgttcaccgcgctg
cggagcgtgcagacgctcgtcaacggcgacaagctggagatcggctacggcgcgcaggac
ctctccgtgcaggactccggcgcctacaccggcgaggtcagcggcgcgatgctcgccgcg
ctggcctgccggtacgtggtcgtcggccactccgagcggcgcgcgctgcacggtgaggac
gacgccgtggtggccggcaaggtgcaggcggcgctgcggcacggcctggtcccgatcctg
tgcgtgggggaggggttggaggtccgccgggccggcgagcacgtcgcgcactgcaccgcc
cagctggacgcggccctggaggggctgaccgccgagcagctcaccggttccggcgcgggc
acggaggccgggggcggcgggggttccgggtccggcggaggggtcgtgatcgcctatgag
ccggtgtgggcgatcggcaccggcgaggtggccacacccgaggacgctcaggaggtgtgc
ggtgccctgcggtcacggctcgccgagcgtttcggcgccgagaccgccggggtcgtccgt
atcctctacggcgggtcggtgaaggccgccaacacggccgggatcctggccgggccggac
gtcgacggtgcactcgtcggtggcgccagcctggacgccgacgagttcgcgcagatctgt
cggacagccgccgacgtcggctga

DBGET integrated database retrieval system