KEGG   Geodermatophilus obscurus: Gobs_2048Help
Entry
Gobs_2048         CDS       T01163                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gob  Geodermatophilus obscurus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gobs_2048
   01230 Biosynthesis of amino acids
    Gobs_2048
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gobs_2048
   00051 Fructose and mannose metabolism
    Gobs_2048
   00562 Inositol phosphate metabolism
    Gobs_2048
Enzymes [BR:gob01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Gobs_2048
Exosome [BR:gob04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Gobs_2048
  Exosomal proteins of bladder cancer cells
   Gobs_2048
  Exosomal proteins of melanoma cells
   Gobs_2048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2128467..2129330
Genome map
AA seq 287 aa AA seqDB search
MARRGTPVRREGRRPLLAGNWKMNLTHLEAIGMVQKLAFSLKETELEAAEVVVLPPFTAL
RSVQTLVNGDKLEIGYGAQDLSVQDSGAYTGEVSGAMLAALACRYVVVGHSERRALHGED
DAVVAGKVQAALRHGLVPILCVGEGLEVRRAGEHVAHCTAQLDAALEGLTAEQLTGSGAG
TEAGGGGGSGSGGGVVIAYEPVWAIGTGEVATPEDAQEVCGALRSRLAERFGAETAGVVR
ILYGGSVKAANTAGILAGPDVDGALVGGASLDADEFAQICRTAADVG
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaggggcaccccggtccgccgcgaggggcgccggccgctcctcgccggcaac
tggaagatgaacctcacccacctcgaggccatcgggatggtgcagaaactcgccttcagc
ctcaaggagaccgagctggaggccgccgaggtcgtcgtcctcccgccgttcaccgcgctg
cggagcgtgcagacgctcgtcaacggcgacaagctggagatcggctacggcgcgcaggac
ctctccgtgcaggactccggcgcctacaccggcgaggtcagcggcgcgatgctcgccgcg
ctggcctgccggtacgtggtcgtcggccactccgagcggcgcgcgctgcacggtgaggac
gacgccgtggtggccggcaaggtgcaggcggcgctgcggcacggcctggtcccgatcctg
tgcgtgggggaggggttggaggtccgccgggccggcgagcacgtcgcgcactgcaccgcc
cagctggacgcggccctggaggggctgaccgccgagcagctcaccggttccggcgcgggc
acggaggccgggggcggcgggggttccgggtccggcggaggggtcgtgatcgcctatgag
ccggtgtgggcgatcggcaccggcgaggtggccacacccgaggacgctcaggaggtgtgc
ggtgccctgcggtcacggctcgccgagcgtttcggcgccgagaccgccggggtcgtccgt
atcctctacggcgggtcggtgaaggccgccaacacggccgggatcctggccgggccggac
gtcgacggtgcactcgtcggtggcgccagcctggacgccgacgagttcgcgcagatctgt
cggacagccgccgacgtcggctga

DBGET integrated database retrieval system