KEGG   Geodermatophilus obscurus: Gobs_2799Help
Entry
Gobs_2799         CDS       T01163                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gob  Geodermatophilus obscurus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gobs_2799
   01230 Biosynthesis of amino acids
    Gobs_2799
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gobs_2799
   00030 Pentose phosphate pathway
    Gobs_2799
   00051 Fructose and mannose metabolism
    Gobs_2799
   00052 Galactose metabolism
    Gobs_2799
  Energy metabolism
   00680 Methane metabolism
    Gobs_2799
Enzymes [BR:gob01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Gobs_2799
Protein phosphatases and associated proteins [BR:gob01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Gobs_2799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2917148..2918470)
Genome map
AA seq 440 aa AA seqDB search
MVSHEDLAVRTLGPCRIDSPLAERLVARETTQHSVVEEDRILFDDTISMAGGRDLPVEQL
PSLEPGGPRKRIYFDPAKTRVGIVTCGGLCPGLNDVIRGLVLELSRHYGVRRIVGFRNGY
RGFVPRYGEDVVDLTPEVVMHIDDEGGTILGTSRGEQDPEEVVDALERLNINILFVIGGD
GTIRGAMDVVRVVGERGLKVAVVGIPKTIDNDIPYIDQSFGFQTAMAEATKSIHAASVEA
RSAPGGIGLVKLMGRHSGFIACYATLAKDDADYVLIPEVPFALDGERGLLEHLRQRVQER
GHAVVVVAEGAGQEYIEGEEPGRDASGNVRFGDIGRLLRKRIVEHLDAHGVENNVRYFDP
SYAIRSVPANPFDSAYCLRLAHAAVHAAMAGRTEVIVARRRRRFVHIPMPLAVSRRNHVD
PLGDLWLSVLEATGQPVRFE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggtcagccacgaggacctcgccgtgcgcacgctcggaccctgccggatcgactccccg
ctcgccgaacggctcgtggcgcgggagacgacccagcactccgtcgtggaggaggaccgg
atcctcttcgacgacacgatctccatggccggtgggcgggatctccccgtcgagcagctg
ccgagcctggagccgggcggcccgcggaagcggatctacttcgaccccgccaagacccgg
gtcgggatcgtcacctgcggagggctgtgtcccggcctgaacgacgtcatccgcgggctg
gtgctcgagctctcccggcactacggggtgcggcggatcgtcggcttccgcaacggctac
cggggcttcgtgccgcggtacggggaggacgtcgtcgacctcacgccggaggtcgtcatg
cacatcgacgacgagggcggcacgatcctcggcacctcccgtggggagcaggatccggag
gaggtcgtcgacgcgctggagcgcctcaacatcaacatcctcttcgtcatcggcggcgac
ggcaccatccgcggggccatggacgtcgtccgcgtggtgggggagcggggcctgaaggtc
gccgtggtcgggatcccgaagacgatcgacaacgacatcccctacatcgaccagagcttc
ggcttccagaccgcgatggccgaggcgaccaagtccatccacgcggcgagcgtcgaggcc
cgctccgcgcccgggggcatcggcctggtcaagctcatgggccggcactccggcttcatc
gcctgctacgcgacgctggccaaggacgacgccgactacgtcctcatccccgaggtgccc
ttcgcgctggacggtgagcgcgggctgctggagcacctgcgccagcgggtgcaggagcgg
gggcacgccgtggtggtcgtcgccgagggcgccgggcaggagtacatcgagggggaggag
ccgggccgggacgcctccggcaacgtccgcttcggtgacatcggccggctgctgcgcaag
cggatcgtcgagcacctggacgcgcacggcgtggagaacaacgtccggtacttcgacccg
agctacgcgatccgcagcgtgccggccaatccgttcgacagcgcctactgcctccgtctg
gcccacgccgccgtgcacgcggcgatggccgggcgcaccgaggtcatcgtcgcccggcga
cggcggaggttcgtgcacatccccatgccgctggcggtcagccgtcgcaaccacgtcgac
ccgctcggcgacctgtggctgtcggtgctggaggccaccgggcagcccgtgcgcttcgag
tga

DBGET integrated database retrieval system