KEGG   Geodermatophilus obscurus: Gobs_3043Help
Entry
Gobs_3043         CDS       T01163                                 

Definition
Uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gob  Geodermatophilus obscurus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Gobs_3043
Enzymes [BR:gob01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Gobs_3043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3189458..3190588
Genome map
AA seq 376 aa AA seqDB search
MTDVLPEAPPGTEAPLPLAGYTVAVTAARRREELGALLARRGARVVYAPAIRIVPLADDT
ELVAATRQVLAQPVDLVVATTGVGFRGWLEAADAWDLPLVEHLRGARVLARGPKARGAIR
GGGLVDAWSPASESSAEVLEHLLAGAEGPLQGRRIAVQLHGDPLPDFVEALRATGAEVVT
VPVYRWVLPEDVEPVRRLVRSVVTGAVDAVTFTSAPAAASLLTVADELGQRAELIAALTD
GVLPVAVGPVTAGPLTAAGIPSVQPERARLGALAREVVARLPERTPVLRVGERDLQVRGH
AVLLDGRVVELAPGPMAVLRSLAARPGTVVAKADLVAGLPGGGDEHAVEMAVTRLRAALG
RGVVETVVKRGYRLAA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgatgtcctgcccgaggccccgccggggaccgaggcaccgctgcccctggccggg
tacaccgtcgcggtgaccgccgcccggcgccgcgaggagctgggtgcgctgctggcccgc
cgcggcgcccgcgtggtgtacgcgccggccatccgcatcgtgccgctggccgacgacacc
gagctggtcgccgcgacgcgccaggtactggcgcagccggtggacctggtcgtggcgacc
accggcgtcggcttccgcgggtggctggaggcggccgacgcgtgggacctgccgctggtg
gagcacctgcgcggcgcccgggtgctcgcgcgcgggcccaaggcgcggggcgccatccgc
ggcggcgggctggtcgacgcctggtcgccggcgtcggagtcctcggccgaggtgctcgag
cacctgctcgccggggccgagggcccgctgcagggacgccgcatcgccgtccagctgcac
ggcgacccgctgccggacttcgtcgaggcgctgcgcgcgaccggcgccgaggtcgtcacc
gtgccggtgtaccgctgggtgctgcccgaggacgtcgagccggtgcgccggctggtgcgc
tcggtggtcaccggcgcggtcgacgcggtgaccttcaccagcgccccggccgccgcgagc
ctgctgaccgtcgccgacgagctcggtcagcgcgccgagctgatcgccgcgctgaccgac
ggcgtcctgccggtggcggtggggccggtgaccgccgggccgctgaccgccgcgggcatc
ccctccgtgcaaccggaacgcgcccggctcggcgccctggcccgcgaggtggtcgcccgg
ctgcccgagcgcaccccggtgctgcgggtgggcgagcgggacctgcaggtgcgcgggcac
gccgtcctgctcgacgggcgggtggtggagctggcgccgggcccgatggcggtgctgcgc
tcgctggccgcgcggccgggcaccgtcgtcgccaaggccgacctcgtcgcggggctgccc
ggcggcggcgacgagcacgccgtggagatggccgtgacccggctgcgcgccgcgctcggc
cgcggcgtggtggagaccgtggtgaagcggggctaccgcctggctgcgtga

DBGET integrated database retrieval system