KEGG   Geodermatophilus obscurus: Gobs_3076Help
Entry
Gobs_3076         CDS       T01163                                 

Definition
(RefSeq) pyridoxal-5'-phosphate-dependent protein subunit beta
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gob  Geodermatophilus obscurus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Gobs_3076
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gobs_3076
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Gobs_3076
Enzymes [BR:gob01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Gobs_3076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3226946..3228112
Genome map
AA seq 388 aa AA seqDB search
MGSMTGSVVVAGCEWLEYDYGPALVPQDRPASFTMWRYRDLLPLPDGPVRYPLPIGGTPL
LPVPALRQEAGTPRLWVKDETRNPTTSNKDRATALVIEDGLRRGIDTITTASTGNAAVST
AFGAAAAGLRAVIFVSLECRPEKIAMMTQAGAWVFQVPAGYAAATDLSRDAARAFGWLDR
NTGANPVTLEAKKTVAFEVWEQLGRVVPDVVVAPVGDGPTLVALDKGFDELVRCGLATRR
PRLVGVQAEHCQPLVRAWQGRTAAPADLDPAATAADGIAVLRAAIGDAVLDAVRRDGGAM
VAVSETALDDAVGVLARRAGLSAEPAGASALAGLGSAVGQGLVDRSETVVLLVTGRGKAA
AGPPDQRRVAVVDGLDEVAQLLAGEETR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtggggagcatgaccgggtcggtcgtcgtggccggctgcgagtggctggagtacgactac
gggccggcgctggtaccgcaggaccgacctgcctccttcacgatgtggcggtaccgggac
ctgctgccgctgccggacggcccggtgcggtacccgctgccgatcggcggcaccccgctg
ctgccggtcccggctctgcggcaggaggcggggacaccgcgcctgtgggtcaaggacgag
acgcgcaacccgacgacgtcgaacaaggaccgcgccaccgcgctggtgatcgaggacggc
ctgcggagggggatcgacacgatcacgaccgcctccaccggcaacgcggcggtctcgacg
gccttcggcgccgcggcggccgggctgcgggcggtcattttcgtgtccctggagtgccgg
ccggagaagatcgcgatgatgacgcaggccggcgcgtgggtgttccaggtcccggccggc
tacgcggctgcgaccgacctctcccgggacgccgcccgggcgttcggttggctggaccgc
aacaccggcgccaacccggtcaccctcgaggccaagaagaccgtggcgttcgaggtgtgg
gagcagctgggccgtgtcgtcccggacgtcgtggtcgcccctgtcggcgacggcccgacg
ctggtggcactggacaagggcttcgacgagctggtccgctgcggcctggccacccggcgt
ccccgcctggtcggcgtccaggccgagcactgccagccgctggtgcgggcctggcagggc
aggaccgccgcgccggccgacctggaccctgctgccacggcggccgacggcatcgcggtg
ctgcgtgcggccatcggcgacgccgtgctcgacgcggtgcgccgggacggcggagcgatg
gtggcggtctccgagacggcgctggacgacgcggtcggcgtgctcgcccgtcgtgcgggc
ctcagcgccgaacccgccggggcctcggcactggccgggctgggatcggccgtcgggcag
ggcctggtggatcgctcggagaccgtcgtcctgctcgtcaccggccggggcaaggcagcg
gctggtccgcccgaccaacgccgcgtcgcggtcgtggacggtctcgacgaggtggcacag
ctgctggccggcgaggagacccggtga

DBGET integrated database retrieval system