KEGG   Geodermatophilus obscurus: Gobs_3093Help
Entry
Gobs_3093         CDS       T01163                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
gob  Geodermatophilus obscurus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Gobs_3093
Enzymes [BR:gob01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Gobs_3093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3245166..3246998
Genome map
AA seq 610 aa AA seqDB search
MTRTPSTDEWGIDATWLDALDEEHQVAEATIERLREVIGTPPADLEDRAPIVARPGDVLE
VDEAEVTLEDGSSRQVDGELPEDFPLGYHWLQAPGGPRRRLIVSPGRCWLPDERAWGWAV
QLYATRSRGSWGIGDLADLRAVREMAAGQGAGFVLINPLHAVAPTPQQEASPYLPATRRF
RNPVYLRVEEAPGADAVDLDAETGHALSDGELIDRDAVWARKREVLRRVFDAAGRDDPAF
PEWWWYQGQKLQDWATWCALADVHGPDWHAWPEELRDPRSGAVGDFVAEHERDVAFHAWL
QWALHLQLERATEGMTVIQDLPIGVAGGGADAWTWQDVLAQGASVGAPPDAFNSQGQDWG
SPPLVPWQLRAADYEPFVESIRATMAGAGGLRIDHVMGLFRLWWVPAGESAADGAYVRYP
AEDLLDIVALESSRAQAVVVGEDLGTVEEGVREAMAEHGILSYRLLWFEEEAPAAWPETA
MAAITTHDLPTVAGLWTGADLEEQRERGTGTDEELERGRTSLLEKLPGVRRNARPDTAVK
RAHELLAQAPSLLLSATLDDAVGERRRPNMPGTTDRPNWSLPLPVTVEDLPAHPLLQTVA
RTLAEGLEGS
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcgcactcccagcacagacgaatggggcatcgacgccacctggctcgacgccctc
gacgaggaacaccaggtcgccgaggccaccatcgagcgcctgcgcgaggtcatcggcacc
ccgccggccgacctcgaggaccgggcccccatcgtggcccgccccggcgacgtgctggag
gtcgacgaggcggaggtgacgctcgaggacgggtcgagccgacaggtggacggcgagctg
cccgaggacttcccgctcggctaccactggctgcaggccccgggcggcccgcgccgccgg
ctcatcgtctcccccggccggtgctggctccccgacgagcgcgcctggggctgggcggtg
cagctgtacgccacccgcagccgcggcagctggggcatcggcgacctcgccgacctgcgc
gccgtccgcgagatggccgccggccagggcgccgggttcgtgctcatcaacccgttgcac
gccgtcgccccgacgccgcagcaggaggccagcccctacctgccggccacccgccggttc
cgcaacccggtgtacctgcgggtcgaggaggcgcccggcgcggacgccgtcgacctcgac
gccgagaccggccacgcgctcagcgacggcgagctcatcgaccgcgacgccgtctgggcg
cgcaagcgggaggtgctgcgccgcgtcttcgacgccgccggccgcgacgaccccgccttc
cccgagtggtggtggtaccagggccagaagctgcaggactgggccacctggtgcgcgctg
gccgacgtgcacggcccggactggcacgcgtggcccgaggagctgcgcgacccgcgcagc
ggcgccgtcggggacttcgtcgccgagcacgagcgcgacgtcgccttccacgcgtggctg
cagtgggcgctgcacctgcagctggaacgggccaccgagggcatgaccgtcatccaggac
ctgccgatcggcgtcgccggcggcggcgcggacgcctggacctggcaggacgtgctggcg
cagggcgcgtccgtcggcgccccgccggacgccttcaactcgcagggccaggactggggc
tccccgccgctggtcccctggcagctgcgcgccgcggactacgagccgttcgtcgagtcg
atccgggccacgatggccggtgccggcggcctgcgcatcgaccacgtcatgggcctgttc
cggctgtggtgggtgcccgccggcgagagcgccgcggacggcgcctacgtgcgctacccg
gccgaggacctgctcgacatcgtcgcgctggagagctcccgcgcgcaggcggtcgtcgtc
ggtgaggacctgggcaccgtcgaggagggcgtccgcgaggcgatggccgagcacggcatc
ctcagctaccggctgctgtggttcgaggaggaggcaccggccgcgtggccggagacggcg
atggccgcgatcaccacgcacgacctgcccaccgtggcggggctgtggaccggcgcggac
ctcgaggagcagcgcgagcgcggcaccgggaccgacgaggagctcgagcgcggccggacg
tcgctgctggagaagctgcccggtgtgcggaggaacgcccggcccgacacggcggtgaag
cgggcgcacgagctgctggcgcaggccccgtcgctgctgctgtcggccaccctggacgac
gccgtcggtgaacggcgccgacccaacatgcccggcaccaccgaccggcccaactggtcg
ctgccgctgccggtgaccgtggaggacctgccggcgcacccgctgctgcagaccgtggcc
cggaccctcgccgagggcctcgaggggtcctga

DBGET integrated database retrieval system