KEGG   Geodermatophilus obscurus: Gobs_3103Help
Entry
Gobs_3103         CDS       T01163                                 

Definition
XRE family transcriptional regulator
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
gob  Geodermatophilus obscurus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gob00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:gob00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3256045..3257556
Genome map
AA seq 503 aa AA seqDB search
MQRIGMLVRDARRHRGLTQQQLAERLGTSQSAVARIEQGGQNLTLELLGRLSEALERELF
SVGPSGPTHLRVSGGVPLRGSVTVKSSKNAAVALLCAALLNRGRTTLRNVARIVEVERIL
DVLRSIGVSATWDTAGRDLTLVVPEQLDLAGIDADAARRTRSIIMFLGPLLHRAPSFDLP
YAGGCDLGTRTVEPHMIALRPFGLEVEARGGSYHAAVTAPGTADRTIVLTERGDTVTENA
LLAAARTDGTTTIRNASSNYMVQDLCLYLQLLGVGVEGLGTTTLVVHGKPVLDADVDYTI
SEDPVEAMSLLTAGIVTDSELTVCRAPIEFLEVELATLAEMGLRYRLSPEYLADNGHTRL
VDVTISPSELKALIDKIHPMPFPGLNIDNLPFFAVIAAAATGSTLIHDWVYDNRAIHLSD
LTRLGADVRLLDPHRVLVTGPTHWSSAEVVCPPALRPAVCILLAMLAAKGTSVLRNVDII
ARGYEQLYERLVEMGARIEVFHD
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcatcggcatgctcgtccgcgacgcccggcggcaccgcgggctcacccagcag
cagctcgccgagcggctcggcaccagccagagcgccgtcgcccgcatcgagcagggcggg
cagaacctcaccctcgaactgctcggccggctctccgaggcgctcgagcgtgagctgttc
agcgtcggcccgtccggccccacccacctgcgggtctccggcggcgtgccgctgcgcggc
agcgtgaccgtgaagtcctccaagaacgccgccgtcgcgctgctgtgcgccgccctgctc
aaccgcggccggacgacgctgcgcaacgtggcccggatcgtggaggtcgagcggatcctc
gacgtgctgcgctcgatcggcgtctcggcgacctgggacacggccggccgcgacctcacc
ctcgtcgtccccgagcagctggacctcgccggcatcgacgccgacgccgcccgccggacc
cgcagcatcatcatgttcctcggcccgctgctgcaccgggcgccgtcgttcgacctgccc
tacgccggcggttgcgacctgggcacccgcaccgtcgagccgcacatgatcgcgctgcgc
cccttcgggctggaggtcgaggcccgcggcggcagctaccacgccgcggtcaccgcgccg
ggcacggcggaccgcaccatcgtgctgaccgagcggggcgacaccgtcaccgagaacgcg
ctgctggccgcggcccgcaccgacgggacgacgaccatccgcaacgccagttccaactac
atggtccaggacctctgcctgtacctgcagctgctcggcgtcggcgtcgaggggctcggc
accaccaccctcgtcgtgcacgggaagccggtgctcgacgccgacgtcgactacacgatc
agtgaggacccggtcgaggcgatgagcctgctgaccgccggcatcgtcaccgactcggag
ctgaccgtgtgccgggcgccgatcgagttcctcgaggtggagctggccaccctcgccgag
atggggctgcgctaccgcctgtcgccggagtacctggccgacaacgggcacacccggctg
gtcgacgtcaccatctccccgtcggagctcaaggcgctgatcgacaagatccacccgatg
ccgttcccgggcctcaacatcgacaacctgccgttcttcgccgtcatcgcggccgcggca
accggctcgacgctgatccacgactgggtctacgacaaccgggccatccacctgtccgac
ctgacccggctcggtgccgacgtccggctgctcgacccgcaccgggtgctggtgaccggc
ccgacccactggtccagcgccgaggtggtctgcccgccggcgctgcgcccggcggtgtgc
atcctgctggcgatgctcgcggccaaggggacgtcggtgctgcgcaacgtcgacatcatc
gcccgcggctacgagcagctctacgagcggctggtcgagatgggcgcccgcatcgaggtc
ttccacgattga

DBGET integrated database retrieval system