KEGG   Geodermatophilus obscurus: Gobs_3177Help
Entry
Gobs_3177         CDS       T01163                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
gob  Geodermatophilus obscurus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gob03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3334976..3335614)
Genome map
AA seq 212 aa AA seqDB search
MIASVNGRVAAVSPDGAVVEVGGVGLAVQCTPGTIARLQVGESARLATSLVVREDSLTLY
GFADDDERQLFELLQTANGVGPRLAQAVLAIHPPREVRRAVSMADVKALMQVPGIGKKGA
ERLILELRDRLGVTSTDTQLDGAAPAGLPAVTPVAPWRDQLASALVGLGWTGKEADAAIG
QLAPLADEQVTSTGSVEVAVLLRQALRLLGRP
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcgagcgtgaacggccgggtggccgccgtgtcgccggacggcgcggtcgtcgag
gtcggcggcgtcggtctggcggtgcagtgcacgccgggcaccatcgcccggctgcaggtg
ggggagagcgcccggctggcgaccagtctcgtggtgcgcgaggactcgctgaccctctac
ggcttcgccgacgacgacgagcgccagttgttcgagctgctgcagacggccaacggcgtg
ggcccgcgcctggcgcaggccgtgctcgccatccacccgccgcgcgaggtgcgccgggcg
gtgtcgatggccgacgtcaaggcgctcatgcaggtccccggcatcggcaagaagggcgcc
gagcggctgatcctcgaactgcgcgaccggctcggcgtcacctcgaccgacacccagctc
gacggtgccgctcctgcgggcctgcccgcggtcacccccgtcgccccgtggcgcgaccag
ctggcctccgccctggtcggcctgggctggacgggcaaggaggccgacgcggcgatcggc
cagctcgccccgctggccgacgagcaggtcacctcgaccggctccgtcgaggtcgccgtc
ctgctgcgccaggcgctgcgcctgctgggccggccgtga

DBGET integrated database retrieval system