KEGG   Geodermatophilus obscurus: Gobs_3215Help
Entry
Gobs_3215         CDS       T01163                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gob  Geodermatophilus obscurus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Gobs_3215
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gobs_3215
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Gobs_3215
Enzymes [BR:gob01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Gobs_3215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3379169..3379966)
Genome map
AA seq 265 aa AA seqDB search
MSQLQDTIARARAEGRSALVAYLPVGYPDVDTSIAAMVAAVEGGADVLEVGVPYSDPGMD
GPVIQQAVDPAVRAGVGMRDVLRAVEAVAAAGAVPVVMSYWNPVERYGVDRFAADLAAAG
GAGAITPDLIPDEAGAWLAAAEAHDLDRVFLVAPSSTDARLAATVAACRGFVYAASTMGV
TGTRATVGDAAEKLVARTRAVTDLPVCVGLGVSNGDQAAEVAGFADGVIVGSAYVRELLE
GRGADGVRRLSQDLAAGVRRPVAVP
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcagctgcaggacaccatcgcccgggcgagggccgaggggcgttcggcgctggtc
gcctacctcccggtcgggtacccggacgtcgacacctcgatcgcggccatggtcgcggcg
gtcgagggcggggccgacgtcctcgaggtcggcgtcccgtacagcgaccccggcatggac
ggcccggtcatccagcaggccgtcgacccggcggtgcgggccggcgtcggcatgcgcgac
gtgctgcgcgccgtcgaggcggtcgccgccgcaggtgcggtcccggtggtgatgagctac
tggaacccggtcgagcgctacggcgtcgaccggttcgccgccgacctggccgccgccggg
ggagccggggccatcacccccgacctcatccccgacgaggcgggggcctggctggccgcc
gcggaggcgcacgacctcgaccgcgtgttcctggtggcaccgtcgtccaccgacgcgcgg
ctggccgcgaccgtcgcggcctgccggggcttcgtctacgccgcctccaccatgggcgtc
accggtacccgggccaccgtgggcgacgcggcggagaagctggtcgcccgcacccgcgcg
gtcaccgacctgccggtctgcgtggggctgggcgtctcgaacggggaccaggccgccgag
gtcgccggcttcgccgacggggtgatcgtcgggtcggcctacgtgcgagagctgctcgag
ggccggggcgccgacggcgtgcgccgcctgtcgcaggacctcgccgcgggcgtgcgccgt
ccggtggccgtgccgtga

DBGET integrated database retrieval system