KEGG   Geodermatophilus obscurus: Gobs_3218Help
Entry
Gobs_3218         CDS       T01163                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gob01100  Metabolic pathways
gob01110  Biosynthesis of secondary metabolites
gob01130  Biosynthesis of antibiotics
gob01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Gobs_3218
Enzymes [BR:gob01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Gobs_3218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh OMPdecase
Motif
Other DBs
NCBI-ProteinID: ADB75823
UniProt: D2SA08
Position
complement(3382013..3382822)
Genome map
AA seq 269 aa AA seqDB search
MSVLDEIVAGVREDLAAREAATPLAEVKAAARDARPPLDALAALRAPGVGVIAEVKRQSP
SRGALADIPDPAVLARQYADGGARVISVLTERRRFGGGQADLAAVRAAVGVPVLCKDFVV
TSYQVHEARAHGADVVLLIVAALEQNALLGLLERVESLGMTALVEVHTEAEADRALSAGA
AVIGVNARDLTTLQVDRSTFERIAPGLPSEVVKVAESGVRGPHDLISYAAAGADAVLVGE
GLVTAGDARQAVADLVTAGAHPATPHTPR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgtgctcgacgagatcgtcgccggcgtccgtgaggacctggcggcccgtgaggcg
gccaccccgctggcggaggtcaaggccgccgcccgggacgcccgcccgcccctcgacgcc
ctcgccgcgctgcgtgcgcccggcgtcggcgtcatcgccgaggtgaagcggcagagcccc
tccaggggcgcgctcgccgacatccccgaccccgcggtgctggcccggcagtacgccgac
ggcggcgcccgggtcatcagcgtgctcaccgagcggcgccgcttcggaggcggccaggcc
gacctcgccgccgtccgcgccgccgtcggcgtcccggtgctgtgcaaggacttcgtcgtc
acgagctaccaggtgcacgaggcgcgtgcccacggggcggacgtcgtcctgctcatcgtg
gccgcgctggagcagaacgccctgctcggtctgctggagcgggtcgagtcgctgggcatg
accgcgctggtcgaggtgcacaccgaggccgaggccgaccgcgcgctgtccgccggcgcc
gcggtgatcggcgtcaacgcccgcgacctcaccacgctgcaggtcgaccgctccaccttc
gagcggatcgcccccgggctgccgtcggaggtggtcaaggtcgccgagtccggcgtccgc
ggcccgcacgacctcatctcctacgcggcggccggcgccgacgccgtcctcgtcggtgag
ggcctggtcaccgccggcgacgcccgccaggcggtcgccgacctggtcacggccggcgcc
cacccggccaccccgcacaccccccgctga

DBGET integrated database retrieval system