KEGG   Geodermatophilus obscurus: Gobs_3326Help
Entry
Gobs_3326         CDS       T01163                                 

Definition
glucokinase, ROK family
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
gob  Geodermatophilus obscurus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gobs_3326
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gobs_3326
   00052 Galactose metabolism
    Gobs_3326
   00500 Starch and sucrose metabolism
    Gobs_3326
   00520 Amino sugar and nucleotide sugar metabolism
    Gobs_3326
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Gobs_3326
   00524 Butirosin and neomycin biosynthesis
    Gobs_3326
Enzymes [BR:gob01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Gobs_3326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3496896..3497885)
Genome map
AA seq 329 aa AA seqDB search
MAGADAADLPALGIDVGGTKVAGGVVAPDGTVLATARRATPGSSVRETEDAIAAVVEVLA
RGHDGPLVGVGVGAAGWFDRTGDTVLFSPHLAWRNSTLRKDLAARLQRPMWVGNDADAAA
WAEYRYGAARGADLALMITLGTGIGGGIVMDGRLQRGSHGVAGEWGHMRVVPEGRLCACG
NRGCWEQYASGTALGQTAREVARSSPAAAALLLERVDGDPDRLTGEHVATAAAEDDPLAL
ELLAEVGAWLGQGIADLSAVLDPEVVVIGGGVSVLGEMVLGPARQRLGRALPGRGFRPGP
RVMAARLGAEAGIVGSADLVRRAVADGPG
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtggccggcgcagacgccgccgacctgcccgcgctgggcatcgacgtcggcggcacgaag
gtggccggtggcgtcgtcgccccggacggcacggtgctggcgaccgcgcggcgggcgacc
cccggatcgtcggtgcgggagaccgaggacgcgatcgccgcggtggtcgaggtgctcgcc
cgcgggcacgacggcccgctggtcggcgtcggcgtgggggcggccggctggttcgaccgc
accggcgacacggtgctgttcagcccgcacctggcctggcggaactcgacgctccgcaag
gacctcgccgcccggctgcagcggccgatgtgggtgggcaacgacgccgacgcggcggcc
tgggccgagtaccgctacggcgcggcccgcggagcggacctggcgctgatgatcaccctg
ggtaccggcatcggtggcggcatcgtcatggacggccgcctgcagcgcggctcgcacggc
gtcgcgggggagtggggccacatgcgcgtcgtccccgaggggcggctgtgcgcgtgcggc
aaccgcgggtgctgggagcagtacgccagcggcacggcgctgggtcagaccgcccgtgag
gtggcccgcagctcaccggccgccgcggccctgctgctcgagcgggtggacggcgacccg
gacaggctcaccggcgagcacgtcgcgaccgccgccgccgaggacgacccgctggcgctg
gagctactcgcggaggtgggcgcctggctcgggcaggggatcgccgacctctccgccgtg
ctggacccggaggtcgtcgtcatcggcggcggggtcagcgtgttgggcgagatggtgctc
ggcccggcgcgtcagcggctgggacgggcactgcccggccgcgggttccgtcccggcccc
cgggtgatggccgcccggctgggcgcggaggccgggatcgtcggttccgccgacctggtc
cgccgggccgtcgccgacggcccggggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system