KEGG   Geodermatophilus obscurus: Gobs_3348Help
Entry
Gobs_3348         CDS       T01163                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00250  Alanine, aspartate and glutamate metabolism
gob01100  Metabolic pathways
gob01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gobs_3348
Enzymes [BR:gob01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Gobs_3348
Peptidases [BR:gob01002]
 Cysteine Peptidases
  Family C44
   Gobs_3348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 QueC NAD_synthase Arginosuc_synth
Motif
Other DBs
NCBI-ProteinID: ADB75950
UniProt: D2SAR5
Position
3518768..3520699
Genome map
AA seq 643 aa AA seqDB search
MCGLLAYLSTDAERVDDTRVKEVHEALHCLRHRGPDETQVWHDARVAFGFNRLAFIDIEH
SHQPMPYADGRYRIVFNGEIYNYVELRQELAALGARFATEGDTEAIVAGYHHWGQDVVRR
LRGMFAFVIWDTQTGTAFGARDPFGIKPLFTARLADGALVFSSEKKALLEMLGGSDAAGG
VDSASLQHYLTLQYVPEPATLHRGIRRIESGTSFTVVDGELHTSRYFHPTFPVRPVAADE
QQGLYDRIAEVLDDSVRVHMRADVTVGSFLSGGIDSTAIAALAKRYNPDLMTFTVGFERE
GYSEIDVAAESAAAIGVEHVTKVVTPEEFAESIPLVVWYLDDPVADPALVPLYFVAREAR
KHVKVVLSGEGADELFGGYNIYREPLSLAAFDKLPGGVRRALGALSARLPDGMRGKDLLR
RGSIPLEQRYYGNARIFRDDELGFLERHDPDLSHVAVTRELYERTRAAGYDDVTAMQYVD
LFTWLRGDILVKADKMTMANSLELRVPFLDPEVFAVAGTLPVGQRVTKETTKYALRRALE
QIVPPHVLNRRKLGFPVPTRHWLAEDLHDWARNTIEESQTDEWLDRRQVLWMLDAHRDNQ
RAGSAVDLSRKLWTLLVFMVWHGVFVEQRIKPEVPETVYPVRL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcctgctcgcctacctgtccaccgacgccgaacgcgtcgacgacacccgcgtc
aaggaggtgcacgaggcactgcactgcctgcgccaccgcggccccgacgagacccaggtc
tggcacgacgcgcgggtcgccttcggcttcaaccggctggccttcatcgacatcgagcac
agccaccagccgatgccctacgccgacggccggtaccggatcgtcttcaacggcgagatc
tacaactacgtggagctgcgccaggagctcgcggccctcggcgcccggttcgccaccgag
ggtgacaccgaggcgatcgtcgccggctaccaccactggggtcaggacgtcgtccggcgg
ctgcgcggcatgttcgccttcgtcatctgggacacccagaccgggacggcgttcggcgcc
cgtgatcccttcggcatcaagccgttgttcaccgcccgcctcgccgacggcgcgctggtc
ttcagctccgagaagaaggcgctgctggagatgctcggcggtagcgacgccgcgggcggc
gtggactccgcctcgctgcagcactacctgacgctgcagtacgtgcccgagcccgcgacg
ctgcaccgcggcatccggcggatcgagagcggcacgagcttcaccgtggtggacggcgag
ctgcacaccagccgctacttccacccgaccttccccgtccggccggtcgccgcggacgag
cagcagggcctctacgaccggatcgccgaggtcctcgacgactcggtgcgggtgcacatg
cgcgccgacgtcaccgtcgggtcgttcctctccggcggcatcgactccaccgccatcgcg
gccctggccaagcgctacaaccccgacctgatgaccttcacggtcggcttcgagcgggag
ggctactcggagatcgacgtcgccgcggagtcggcggccgcgatcggcgtcgagcacgtg
acgaaggtggtcacccccgaggagttcgccgagtcgatcccgctggtcgtctggtacctc
gacgaccccgtcgccgaccccgcgctcgtgccgctgtacttcgtggcccgcgaggcgcgc
aagcacgtgaaggtggtgctctccggcgagggcgccgacgagctcttcggcggctacaac
atctaccgtgagccgctgtcgctggcggcgttcgacaagctgcccgggggcgtccgccgc
gcgctgggcgcgctgtcggcgcggctgcccgacggcatgcgcggcaaggacctgctgcgc
cgcggctccatcccgctcgagcagcggtactacggcaacgcccggatcttccgggacgac
gagctcggcttcctcgagcgccacgaccccgacctgtcacacgtcgccgtgacccgcgag
ctctacgagcggacccgggccgcgggctacgacgacgtgaccgccatgcagtacgtggac
ctgttcacctggctgcgcggcgacatcctggtcaaggccgacaagatgaccatggccaac
tcgctggagctgcgggtgcccttcctggaccccgaggtgttcgccgtcgccggcacgctg
ccggtcggtcagcgggtcaccaaggagacgacgaagtacgcgctgcgccgcgcgcttgag
cagatcgtgccgccgcacgtgctcaaccggcgcaagctcggcttccccgtccccacccgg
cactggctggccgaggacctgcacgactgggcgcggaacaccatcgaggagagccagacc
gacgagtggctcgaccggcgtcaggtcctctggatgctcgacgcccaccgggacaaccag
cgggccggctctgcggtcgacctctcccgcaagctgtggacgctgctggtgttcatggtc
tggcacggcgtcttcgtcgagcagcggatcaagcccgaggtccccgagacggtctacccg
gtccggctgtag

DBGET integrated database retrieval system