KEGG   Geodermatophilus obscurus: Gobs_3361Help
Entry
Gobs_3361         CDS       T01163                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gob  Geodermatophilus obscurus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gobs_3361
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Gobs_3361
  Amino acid metabolism
   00310 Lysine degradation
    Gobs_3361
Enzymes [BR:gob01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Gobs_3361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3530487..3532379
Genome map
AA seq 630 aa AA seqDB search
MPTSVTMPALGESVTEGTVTRWLKQEGEQVEVDEPLLEVSTDKVDTEIPSPAAGVLSRIL
VSEDETVEVGAELAVIGGDGDGGGAGGPESAEDTDTTPQTPVDQVEDAGPGPSDEQQPAA
AAPASDGGSGGGGGGEGTPVTMPALGESVTEGTVTRWLKSVGDEVTADEPLLEVSTDKVD
TEIPAPVSGTLLSISVDEDETVEVGAELAVIGSGSAGGGAPAQAPAPSAPAQQEPQSQQE
PREPAPPAQATQPTPQADPTPQRAQPSSEQPGADYGSGGVLPSTSPTDAPSPAQAVAPQA
PAAPKTPAPAPAGDGGGQYVTPLVRRLAADRGVDLSSVTGTGVGGRIRKQDVIAAAEKAA
APAEAPAPAAAASGRPTPSPSPAAQPDTSLRGRTEKLSRLRTVIARRMVESLQVSAQLTT
VVEADVTTIARLRDRAKRDFEAREGVKLSFLPFFAKAAVEALKAHPAVNSSIDLEAGTVT
YHDAENLGVAVDTERGLLVPVIRDAGDLSIGGLARKIADLAERTRTNKVTPDELGGGTFT
LTNTGSRGALFDTPIINQPQVAILGLGSVVKRPVVVQDPGLGEVIAVRSMVYLALTYDHR
IVDGADAARFLVTVKERLEAGQFQGELGLS
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgccgacctccgtcaccatgcccgccctgggcgagagcgtcaccgagggcacggtcacc
cgatggctcaagcaggagggtgagcaggtcgaggtcgacgagcccctcctcgaggtctcg
accgacaaggtcgacaccgagatcccctcgccggccgccggcgtgctgagcaggatcctg
gtctccgaggacgagacggtggaggtcggcgcagagctcgcggtcatcggcggggacggc
gacggcggcggcgcgggcggccccgagtcggccgaggacaccgacaccaccccgcagacc
ccggtcgatcaggtcgaggacgccggtcctggtccgtcggacgagcagcagccggccgcg
gccgcaccggcttccgacggcggctccggcggtggtggcggcggtgaggggacgccggtg
accatgccggcgctcggcgagagcgtcaccgagggcacggtcacccgctggctgaagtcc
gtcggcgacgaggtgaccgccgacgagccgctgctggaggtctccaccgacaaggtcgac
accgagatccccgcgccggtgtcgggcacgctcctgtcgatttcggtggacgaggacgag
acggtggaggtcggtgcggagctggccgtcatcggctccgggtccgcgggcgggggcgcc
ccggcgcaggccccggctccctcggccccggcccagcaggagccgcagtcacagcaggag
ccgcgcgagccggcgccgccggcgcaggccacgcagccgacgccgcaggccgacccgacg
ccgcagcgggcgcagccgtcctcggagcagcccggtgccgactacggctccggcggggtg
ctgccgagcacctcccccaccgacgcgccgtcgcccgcccaggcggtcgccccgcaggcg
cccgccgcgccgaagaccccggctccggctcctgccggtgacgggggcggtcagtacgtc
accccgctggtgcgccggttggccgccgaccgcggcgtcgacctgtcctcggtgaccggc
acaggcgtcggtgggcggatccgcaagcaggacgtcatcgccgctgcggagaaggccgcc
gcaccggcggaggccccggctccggccgccgcggcctcgggccggccgacgccgagcccg
tcgccggcggcccaacccgacacctcgctgcgcgggcgcaccgagaagctatcccggctg
cgcaccgtcatcgcccgtcggatggtggagtcactgcaggtcagcgcccagctgacgacg
gtcgtggaggccgacgtcacgaccatcgcgcggctgcgggaccgcgccaagcgcgacttc
gaggcccgcgagggcgtcaagctgtcgttcctgccgttcttcgcgaaggcggcggtcgag
gcgctcaaggcccacccggccgtgaactcctcgatcgacctcgaggcgggcacggtgacc
taccacgacgccgagaacctgggcgtcgcggtcgacaccgagcggggcctgctggtgccg
gtgatcagggacgccggtgacctgagcatcggcgggctggcccgcaagatcgccgacctg
gcggagcgcacccgcaccaacaaggtgaccccggacgagctcggcggcggcaccttcacg
ctgaccaacaccggcagccgtggggcgctgttcgacacgccgatcatcaaccagcctcag
gtggcgatcctcggcctgggcagcgtcgtcaagcgcccggtcgtcgtccaggaccccggc
ctcggcgaggtcatcgcggtccggtcgatggtctacctggcgctgacctacgaccaccgg
atcgtcgacggcgccgacgccgcccgcttcctcgtcacggtgaaggagcggctggaggcc
ggtcagttccagggcgagctcggcctctcctga

DBGET integrated database retrieval system