KEGG   Geodermatophilus obscurus: Gobs_3361Help
Entry
Gobs_3361         CDS       T01163                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gob  Geodermatophilus obscurus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gobs_3361
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Gobs_3361
  Amino acid metabolism
   00310 Lysine degradation
    Gobs_3361
Enzymes [BR:gob01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Gobs_3361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3530487..3532379
Genome map
AA seq 630 aa AA seqDB search
MPTSVTMPALGESVTEGTVTRWLKQEGEQVEVDEPLLEVSTDKVDTEIPSPAAGVLSRIL
VSEDETVEVGAELAVIGGDGDGGGAGGPESAEDTDTTPQTPVDQVEDAGPGPSDEQQPAA
AAPASDGGSGGGGGGEGTPVTMPALGESVTEGTVTRWLKSVGDEVTADEPLLEVSTDKVD
TEIPAPVSGTLLSISVDEDETVEVGAELAVIGSGSAGGGAPAQAPAPSAPAQQEPQSQQE
PREPAPPAQATQPTPQADPTPQRAQPSSEQPGADYGSGGVLPSTSPTDAPSPAQAVAPQA
PAAPKTPAPAPAGDGGGQYVTPLVRRLAADRGVDLSSVTGTGVGGRIRKQDVIAAAEKAA
APAEAPAPAAAASGRPTPSPSPAAQPDTSLRGRTEKLSRLRTVIARRMVESLQVSAQLTT
VVEADVTTIARLRDRAKRDFEAREGVKLSFLPFFAKAAVEALKAHPAVNSSIDLEAGTVT
YHDAENLGVAVDTERGLLVPVIRDAGDLSIGGLARKIADLAERTRTNKVTPDELGGGTFT
LTNTGSRGALFDTPIINQPQVAILGLGSVVKRPVVVQDPGLGEVIAVRSMVYLALTYDHR
IVDGADAARFLVTVKERLEAGQFQGELGLS
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgccgacctccgtcaccatgcccgccctgggcgagagcgtcaccgagggcacggtcacc
cgatggctcaagcaggagggtgagcaggtcgaggtcgacgagcccctcctcgaggtctcg
accgacaaggtcgacaccgagatcccctcgccggccgccggcgtgctgagcaggatcctg
gtctccgaggacgagacggtggaggtcggcgcagagctcgcggtcatcggcggggacggc
gacggcggcggcgcgggcggccccgagtcggccgaggacaccgacaccaccccgcagacc
ccggtcgatcaggtcgaggacgccggtcctggtccgtcggacgagcagcagccggccgcg
gccgcaccggcttccgacggcggctccggcggtggtggcggcggtgaggggacgccggtg
accatgccggcgctcggcgagagcgtcaccgagggcacggtcacccgctggctgaagtcc
gtcggcgacgaggtgaccgccgacgagccgctgctggaggtctccaccgacaaggtcgac
accgagatccccgcgccggtgtcgggcacgctcctgtcgatttcggtggacgaggacgag
acggtggaggtcggtgcggagctggccgtcatcggctccgggtccgcgggcgggggcgcc
ccggcgcaggccccggctccctcggccccggcccagcaggagccgcagtcacagcaggag
ccgcgcgagccggcgccgccggcgcaggccacgcagccgacgccgcaggccgacccgacg
ccgcagcgggcgcagccgtcctcggagcagcccggtgccgactacggctccggcggggtg
ctgccgagcacctcccccaccgacgcgccgtcgcccgcccaggcggtcgccccgcaggcg
cccgccgcgccgaagaccccggctccggctcctgccggtgacgggggcggtcagtacgtc
accccgctggtgcgccggttggccgccgaccgcggcgtcgacctgtcctcggtgaccggc
acaggcgtcggtgggcggatccgcaagcaggacgtcatcgccgctgcggagaaggccgcc
gcaccggcggaggccccggctccggccgccgcggcctcgggccggccgacgccgagcccg
tcgccggcggcccaacccgacacctcgctgcgcgggcgcaccgagaagctatcccggctg
cgcaccgtcatcgcccgtcggatggtggagtcactgcaggtcagcgcccagctgacgacg
gtcgtggaggccgacgtcacgaccatcgcgcggctgcgggaccgcgccaagcgcgacttc
gaggcccgcgagggcgtcaagctgtcgttcctgccgttcttcgcgaaggcggcggtcgag
gcgctcaaggcccacccggccgtgaactcctcgatcgacctcgaggcgggcacggtgacc
taccacgacgccgagaacctgggcgtcgcggtcgacaccgagcggggcctgctggtgccg
gtgatcagggacgccggtgacctgagcatcggcgggctggcccgcaagatcgccgacctg
gcggagcgcacccgcaccaacaaggtgaccccggacgagctcggcggcggcaccttcacg
ctgaccaacaccggcagccgtggggcgctgttcgacacgccgatcatcaaccagcctcag
gtggcgatcctcggcctgggcagcgtcgtcaagcgcccggtcgtcgtccaggaccccggc
ctcggcgaggtcatcgcggtccggtcgatggtctacctggcgctgacctacgaccaccgg
atcgtcgacggcgccgacgccgcccgcttcctcgtcacggtgaaggagcggctggaggcc
ggtcagttccagggcgagctcggcctctcctga

DBGET integrated database retrieval system