KEGG   Geodermatophilus obscurus: Gobs_3773Help
Entry
Gobs_3773         CDS       T01163                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00071  Fatty acid degradation
gob00280  Valine, leucine and isoleucine degradation
gob00281  Geraniol degradation
gob00310  Lysine degradation
gob00360  Phenylalanine metabolism
gob00362  Benzoate degradation
gob00380  Tryptophan metabolism
gob00410  beta-Alanine metabolism
gob00627  Aminobenzoate degradation
gob00640  Propanoate metabolism
gob00650  Butanoate metabolism
gob00903  Limonene and pinene degradation
gob00930  Caprolactam degradation
gob01100  Metabolic pathways
gob01110  Biosynthesis of secondary metabolites
gob01120  Microbial metabolism in diverse environments
gob01130  Biosynthesis of antibiotics
gob01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Gobs_3773
   00650 Butanoate metabolism
    Gobs_3773
  Lipid metabolism
   00071 Fatty acid degradation
    Gobs_3773
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Gobs_3773
   00310 Lysine degradation
    Gobs_3773
   00360 Phenylalanine metabolism
    Gobs_3773
   00380 Tryptophan metabolism
    Gobs_3773
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Gobs_3773
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Gobs_3773
   00281 Geraniol degradation
    Gobs_3773
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Gobs_3773
   00627 Aminobenzoate degradation
    Gobs_3773
   00930 Caprolactam degradation
    Gobs_3773
Enzymes [BR:gob01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Gobs_3773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADB76350
UniProt: D2SD01
Position
complement(3954774..3955511)
Genome map
AA seq 245 aa AA seqDB search
MGQIQLERHGGVAVVTVDSPEVKNGLTPEMGLQLSELCDEVDADPAVGAAVVRGAGGTFC
SGADRRRWTPGSDQAEDKTYKELGAVYTAFRRVGTLQVPTIAAVRGAAVGAGINLALSTD
LRIVSESARLLAGFLRIGLHPGGGYFTISSRTAGREATAAMGLFSEEIDGVRAAEIGLAW
KAVPDDQVEDLALELAGRAAKDPELAREAVRSFRTEAGPPGIGWEAALHFERATQMWSQR
RRETA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgggacagatccagttggagcggcacggcggcgtggccgtggtcacggtcgactcgccc
gaggtcaagaacgggctgaccccggagatggggctgcagctgtcggagctgtgcgacgag
gtggacgccgacccggcggtcggcgcggccgtcgtccggggcgcgggcggcaccttctgc
tccggcgcggaccgccggcgctggacgccgggcagcgaccaggccgaggacaagacctac
aaggagctcggcgcggtctacaccgccttccgccgggtgggcacgctgcaggtgccgacc
atcgccgccgtccgcggcgccgcggtcggcgcggggatcaacctggccctctccaccgac
ctgcgcatcgtctccgagagcgcccggctgctcgccgggttcctgcgcatcggcctgcac
cccggcggcggctacttcacgatcagcagccggacggcgggccgcgaggccaccgccgcg
atgggactgttcagcgaggagatcgacggcgtgcgcgccgcggagatcggcctggcctgg
aaggccgtgcccgacgaccaggtcgaggacctcgccctggagctcgccggccgcgccgcc
aaggacccggagctggcccgcgaggcggtccgctccttccgtaccgaggccggcccgccc
gggatcggctgggaggccgcgctgcacttcgagcgggccacccagatgtggtcgcagcgg
cggcgcgagaccgcctga

DBGET integrated database retrieval system