KEGG   Geodermatophilus obscurus: Gobs_3945Help
Entry
Gobs_3945         CDS       T01163                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
gob  Geodermatophilus obscurus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gob00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:gob00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4137886..4138416)
Genome map
AA seq 176 aa AA seqDB search
MAVGLVWAQARGGVIGADGRLPWHLPEDLRLFRELTTGSTVVMGRRTWESLPERFRPLPG
RRNVVLTTDRSWAADGAERVDGVEDVLARTDDGDLWVIGGGRVYAAFLPHADRVVVTDVD
TDVEGDTWAPQLGAEWARVSRTPASGWSASTTGLRYAVSGYTRAATDADVSAGTGR
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtcgggctggtctgggcgcaggcccgcggcggggtgatcggggccgacggccgg
ctgccctggcacctgcccgaggacctccgcctgttccgcgagctcaccacgggcagcacg
gtcgtcatgggccggcgcacctgggagtcgctgcccgagcggttccgcccgctgcccgga
cggcgcaacgtcgtcctcaccaccgaccggtcgtgggccgccgacggcgccgagcgggtg
gacggggtcgaggacgtgctggcgcgcacggacgacggggacctctgggtcatcggcggt
ggccgggtctacgccgcgttcctcccgcacgccgaccgggtggtcgtcaccgacgtcgac
accgacgtcgagggcgacacctgggccccgcagctgggcgcggaatgggcgcgggtgtcg
cgcaccccggcgtcgggctggtcggcgtccaccaccggcctgcggtacgcggtgtcgggg
tacacgcgcgcagcgaccgacgccgacgtgtcggccgggacgggtcggtag

DBGET integrated database retrieval system