KEGG   Geodermatophilus obscurus: Gobs_3975Help
Entry
Gobs_3975         CDS       T01163                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00900  Terpenoid backbone biosynthesis
gob01100  Metabolic pathways
gob01110  Biosynthesis of secondary metabolites
gob01130  Biosynthesis of antibiotics
Module
gob_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Gobs_3975
Enzymes [BR:gob01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Gobs_3975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C
Motif
Other DBs
NCBI-ProteinID: ADB76542
UniProt: D2SDX6
Position
complement(4174179..4175375)
Genome map
AA seq 398 aa AA seqDB search
MDGVREVTVLGSTGSIGRQAIAVARQNPDRLRITGLAAGGGDVARLAEQALSLGVRTVAV
AKATAAQDLQLAFYAAASQRGWSRGEYALPEILAGPRAAEELAARPADVVLNGITGSIGL
RPTLAALQAGRTVALANKESLVAGGELVTAAAAPGQLVPVDSEHSALAQCLRGGHMSEVA
RLVLTASGGPFRGRTAAELADVTVEQALAHPTWAMGPVVTINSATLVNKGLELIEAHLLF
DVPLADVDVVVHPQSIVHSMVTFADGATIAQASPPDMRLPIALALAWPDRLPHVQPALDW
SAASTWEFAPLDDEAFPAVALARSAGEAGGVAPAVYNAANEEAVAAFLAGRLPFRGIVDL
VARTLDDAPDLGAPTCVEDVLAAEGWARQHAGRVIAGG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtggacggcgtgcgcgaggtgacggtgctgggctccaccgggtcgatcggccggcaggcc
atcgcggtggcccggcagaacccggaccggctgcggatcaccggcctggccgccggcggc
ggggacgtcgcccggctcgccgagcaggcgctgtccctcggcgtccgcaccgtcgcggtg
gcgaaggcgaccgccgcgcaggacctccagctggccttctacgccgcggcctcccagcgc
ggctggtcccggggggagtacgcgctgccggagatcctcgccggcccgcgggcggccgag
gagctcgccgcccgccccgccgacgtcgtcctcaacggcatcaccggctcgatcggactg
cggcccacgctggcggcgctgcaggccggccgcaccgttgcgctggccaacaaggagtcg
ctcgtggccggcggtgagctggtcaccgcggcggccgcgcccggccagctggtgccggtc
gactccgagcactcggcgctggcgcagtgcctgcgcggcgggcacatgagcgaggtggcc
cggctggtgctcaccgccagcggcgggccgttccgcggccgcaccgccgccgagctggcc
gacgtcaccgtcgagcaggcgctggcgcacccgacgtgggcgatgggcccggtggtgacg
atcaactccgcgactctggtcaacaagggcctggagctcatcgaggcgcacctgctcttc
gacgtccccctcgccgacgtcgacgtcgtggtgcacccgcagtcgatcgtgcactcgatg
gtgaccttcgccgacggcgccaccatcgcccaggccagcccgccggacatgcggctgccg
atcgcgctggccctggcctggcccgaccggctgccgcacgtccagccggccctggactgg
tcggcggcgagcacctgggagttcgcgccgctggacgacgaggcgttcccggccgtcgcg
ctggcccgctccgccggcgaggcggggggcgtggccccggcggtctacaacgcggccaac
gaggaggcggtggcggcgttcctggcgggtcggctgccgttccggggcatcgtcgacctc
gtcgcgcgtaccctcgacgacgcgccggacctcggcgcccccacctgcgtcgaggacgtc
ctggcggcggaggggtgggcccggcagcacgccggacgtgtgatcgccggaggctga

DBGET integrated database retrieval system