KEGG   Geodermatophilus obscurus: Gobs_4152Help
Entry
Gobs_4152         CDS       T01163                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gob  Geodermatophilus obscurus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Gobs_4152
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gobs_4152
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Gobs_4152
Enzymes [BR:gob01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Gobs_4152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4364253..4365338)
Genome map
AA seq 361 aa AA seqDB search
MTTQLPVRGTVSPLWPGLIEAYRSRLPVSDSTPVVTLQEGATPLVPAQELSRRTGCDVYL
KVEGANPTGSFKDRGMTMAITKAREEGAQAVICASTGNTSASAAAYAARAGMVCAVLVPQ
GKIALGKLAQALVHGAKLLQVDGNFDDCLALASKLAIDYPVSLVNSVNQFRIEGQKTASF
EIVDVLGDAPDVHCLPVGNAGNITAYWQGYREYAADGTATRTPRMWGFQAAGAAPIVTGQ
VVEQPQTIATAIRIGNPASWTKALAARDESGGRIDAVTDRAILAAYRLLARTEAVFVEPA
SAASVAGLLQVAEAGGLEPGQRVVCTVTGNGLKDPEWAISGAPAPVTVPVDAAAAAAQLG
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcagctgcccgtccggggcaccgtctcaccgctgtggccggggctcatcgag
gcctatcgctcgcggctgccggtcagcgacagcacaccggtggtcaccctccaggagggg
gcgaccccgttggtgccggcgcaggagctgtcccgccgcaccggctgcgacgtctacctc
aaggtcgagggcgccaacccgaccgggtcgttcaaggaccgcgggatgaccatggccatc
accaaggccagggaggagggcgcccaggcggtcatctgcgcgtccaccggcaacaccagc
gccagcgccgccgcctacgccgcccgcgccgggatggtctgcgccgtcctcgtcccgcag
ggcaagatcgcgctgggcaagctggcgcaggcgctggtgcacggcgccaagctgctgcag
gtcgacggcaacttcgacgactgcctcgcgctggccagcaagctggcgatcgactacccg
gtcagcctggtcaacagcgtcaaccagttccggatcgaggggcagaagaccgcctcgttc
gagatcgtcgacgtgctcggcgacgccccggacgtccactgcctgccggtcggcaacgcc
ggcaacatcaccgcgtactggcagggctaccgcgagtacgccgccgacggcaccgccacg
aggacaccgcgcatgtggggcttccaggccgccggcgccgccccgatcgtcaccgggcag
gtcgtcgagcagccgcagaccatcgccaccgccatccgcatcggcaacccggcgtcctgg
accaaggcgctggccgcccgggacgagtccggcggccggatcgacgccgtcaccgaccgg
gccatcctcgcggcctaccggctgctggcccgcaccgaggcggtcttcgtcgagccggcg
tccgctgcgtcggtcgccggtctgctgcaggtcgccgaggccggtgggctcgagccggga
cagcgggtcgtctgcaccgtcaccggcaacgggctcaaggacccggagtgggcgatctcc
ggcgcgccggccccggtgaccgtgccggtcgacgccgcagccgccgccgcgcagctcggc
ctgtga

DBGET integrated database retrieval system