KEGG   Geodermatophilus obscurus: Gobs_4152Help
Entry
Gobs_4152         CDS       T01163                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00260  Glycine, serine and threonine metabolism
gob00750  Vitamin B6 metabolism
gob01100  Metabolic pathways
gob01110  Biosynthesis of secondary metabolites
gob01120  Microbial metabolism in diverse environments
gob01230  Biosynthesis of amino acids
Module
gob_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gobs_4152
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Gobs_4152
Enzymes [BR:gob01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Gobs_4152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ADB76715
UniProt: D2SES9
Position
complement(4364253..4365338)
Genome map
AA seq 361 aa AA seqDB search
MTTQLPVRGTVSPLWPGLIEAYRSRLPVSDSTPVVTLQEGATPLVPAQELSRRTGCDVYL
KVEGANPTGSFKDRGMTMAITKAREEGAQAVICASTGNTSASAAAYAARAGMVCAVLVPQ
GKIALGKLAQALVHGAKLLQVDGNFDDCLALASKLAIDYPVSLVNSVNQFRIEGQKTASF
EIVDVLGDAPDVHCLPVGNAGNITAYWQGYREYAADGTATRTPRMWGFQAAGAAPIVTGQ
VVEQPQTIATAIRIGNPASWTKALAARDESGGRIDAVTDRAILAAYRLLARTEAVFVEPA
SAASVAGLLQVAEAGGLEPGQRVVCTVTGNGLKDPEWAISGAPAPVTVPVDAAAAAAQLG
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcagctgcccgtccggggcaccgtctcaccgctgtggccggggctcatcgag
gcctatcgctcgcggctgccggtcagcgacagcacaccggtggtcaccctccaggagggg
gcgaccccgttggtgccggcgcaggagctgtcccgccgcaccggctgcgacgtctacctc
aaggtcgagggcgccaacccgaccgggtcgttcaaggaccgcgggatgaccatggccatc
accaaggccagggaggagggcgcccaggcggtcatctgcgcgtccaccggcaacaccagc
gccagcgccgccgcctacgccgcccgcgccgggatggtctgcgccgtcctcgtcccgcag
ggcaagatcgcgctgggcaagctggcgcaggcgctggtgcacggcgccaagctgctgcag
gtcgacggcaacttcgacgactgcctcgcgctggccagcaagctggcgatcgactacccg
gtcagcctggtcaacagcgtcaaccagttccggatcgaggggcagaagaccgcctcgttc
gagatcgtcgacgtgctcggcgacgccccggacgtccactgcctgccggtcggcaacgcc
ggcaacatcaccgcgtactggcagggctaccgcgagtacgccgccgacggcaccgccacg
aggacaccgcgcatgtggggcttccaggccgccggcgccgccccgatcgtcaccgggcag
gtcgtcgagcagccgcagaccatcgccaccgccatccgcatcggcaacccggcgtcctgg
accaaggcgctggccgcccgggacgagtccggcggccggatcgacgccgtcaccgaccgg
gccatcctcgcggcctaccggctgctggcccgcaccgaggcggtcttcgtcgagccggcg
tccgctgcgtcggtcgccggtctgctgcaggtcgccgaggccggtgggctcgagccggga
cagcgggtcgtctgcaccgtcaccggcaacgggctcaaggacccggagtgggcgatctcc
ggcgcgccggccccggtgaccgtgccggtcgacgccgcagccgccgccgcgcagctcggc
ctgtga

DBGET integrated database retrieval system