KEGG   Geodermatophilus obscurus: Gobs_4398Help
Entry
Gobs_4398         CDS       T01163                                 

Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
gob  Geodermatophilus obscurus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Gobs_4398
Enzymes [BR:gob01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Gobs_4398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4630718..4631995)
Genome map
AA seq 425 aa AA seqDB search
MTFDAIDVIRTKRDGGRLSAEQIRWVIDAYTRGVVPDEQVSALLMAVFFRGMAPEELAVW
TQAMIDSGERKDLSPLGRPTADKHSTGGVGDKTTLPLAPLVAACGVAVPQLSGRGLGHTG
GTLDKLESIPGWRADVHEEAYLAQLREVGAVICAAGNDLAPADKKLYALRDVTGTVESIP
LIASSIMSKKIAEGADALVLDVKTGSGAFMKDPEASRELARTMVGLGEAAGVHTVALVTA
MDRPLGRAAGNAVEVAESVEVLAGGGPADVVELTLALAREMLAGVGRGDVDPAEALRDGR
AMDVWRRMISAQGGDPDAPLPHPAEKHVVVAPATGTLTRLDAYAFGVAAWRLGAGRARKE
DPVSAAAGVTWTAGVGEQVVAGQPLLELHTDDPDRIPRALEALEGAVGVDTGEQPLPLLL
DRITA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgaccttcgacgcgatcgacgtcatccgcaccaagcgggacggcgggcggctgagcgcc
gagcagatccgctgggtgatcgacgcctacacccgcggcgtcgtgcccgacgagcaggtc
agcgcgctgctcatggcggtgttcttccgcggcatggcgcccgaggagctcgccgtctgg
acgcaggcgatgatcgactccggcgagcgcaaggacctgtccccgctcggccggccgacc
gccgacaagcactcgaccggcggcgtcggcgacaagaccacgctgccgctcgcgccgctg
gtcgccgcctgcggcgtcgcggtgccgcagctgtccgggcggggcctgggccacaccggc
ggcaccctggacaagctcgagtcgatccccggctggcgggccgacgtccacgaggaggcc
tacctggcgcagctgcgcgaggtgggcgcggtcatctgcgcggccggcaacgacctggcg
ccggcggacaagaagctgtacgcgctgcgcgacgtcaccggcaccgtcgagtcgatcccg
ctgatcgccagctcgatcatgagcaagaagatcgccgagggtgccgacgccctggtgctc
gacgtgaagaccgggtcgggcgcgttcatgaaggaccccgaggcatcccgcgagctggcc
cgcaccatggtcggcctcggtgaggcggccggcgtgcacacggtcgcgctggtgaccgcg
atggaccggccgctgggtcgcgccgccggcaacgccgtcgaggtggccgagtcggtggag
gtgctcgccggcggtggcccggccgacgtcgtcgagctgaccctggcgctggcccgcgag
atgctggccggcgtcgggcggggcgacgtcgacccggccgaggccctccgcgacgggcgg
gccatggacgtctggcggcggatgatcagcgcgcagggcggcgaccccgacgcgccgctg
ccgcacccggccgagaagcacgtggtggtcgctccggccaccggcacgctgacccggctg
gacgcctacgccttcggcgtggccgcctggcggctgggtgcggggcgggcgcgcaaggag
gacccggtgtccgcggcggccggtgtcacctggaccgccggggtgggcgagcaggtggtg
gccggtcagccgctgctggagctgcacaccgacgacccggaccgcatcccgcgggcgctg
gaggcgctggagggcgcggtcggcgtcgacaccggtgagcagcccctgccgctgctgctg
gaccgcatcacggcctga

DBGET integrated database retrieval system