KEGG   Geodermatophilus obscurus: Gobs_4605Help
Entry
Gobs_4605         CDS       T01163                                 

Definition
(RefSeq) phosphoglycerate mutase 1 family (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
gob  Geodermatophilus obscurus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gobs_4605
   01230 Biosynthesis of amino acids
    Gobs_4605
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gobs_4605
  Energy metabolism
   00680 Methane metabolism
    Gobs_4605
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gobs_4605
Enzymes [BR:gob01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Gobs_4605
Exosome [BR:gob04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Gobs_4605
  Exosomal proteins of melanoma cells
   Gobs_4605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4826169..4826942)
Genome map
AA seq 257 aa AA seqDB search
MTMYSPQTRPGTLVLLRHGESEWNKANLFTGWVDVPLSEKGRGEAARGGELLAEHGLLPQ
VAHTSVLTRAITTAELALAAADRQWIPVKRSWRLNERHYGALQGKDKAATLAEYGEEQFT
VWRRSYSTPPPPIEPGSEYSQDGDARYAVLPPEVRPQTECLADVVVRMLPYWYDAIVPDL
RAGLTVLVAAHGNSLRALVKHLDGMDEDEVVGLNIPTGVPLRYNLDDDLRPTNPGGRYLD
PDAAAAAIEAVKNQGKR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatgtactcgccccagacccgccccggcacgctcgtgctgctccgccacggcgag
agcgagtggaacaaggccaacctgttcaccggctgggtggacgtgccgctgtcggagaag
ggccgcggcgaggccgcccggggcggtgagctcctcgctgagcacggcctgctgccgcag
gtggcgcacacctcggtgctcacgcgggcgatcaccaccgccgagctggcgctggccgcc
gcggaccggcagtggatcccggtcaagcgctcctggcggctcaacgagcggcactacggc
gcgctgcagggcaaggacaaggccgccacgctcgccgagtacggcgaggagcagttcacg
gtctggcgccgctcctacagcaccccgccgccgcccatcgagccgggcagcgagtactcc
caggacggcgacgcgcgctacgccgtgctgccgccggaggtgcgcccgcagaccgagtgc
ctggccgacgtcgtcgtccggatgctgccgtactggtacgacgcaatcgtgcccgacctg
cgcgcggggctgaccgtgctcgtcgccgcgcacggcaacagcctgcgggcgctggtgaag
cacctggacgggatggacgaggacgaggtcgtggggctcaacatccccaccggcgtcccg
ctgcgctacaacctggacgacgacctgcgcccgaccaaccccggtggccggtacctcgac
cccgacgccgcagccgccgccatcgaggccgtcaagaaccagggcaagcgctga

DBGET integrated database retrieval system