KEGG   Geodermatophilus obscurus: Gobs_4605Help
Entry
Gobs_4605         CDS       T01163                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00010  Glycolysis / Gluconeogenesis
gob00260  Glycine, serine and threonine metabolism
gob00680  Methane metabolism
gob01100  Metabolic pathways
gob01110  Biosynthesis of secondary metabolites
gob01120  Microbial metabolism in diverse environments
gob01130  Biosynthesis of antibiotics
gob01200  Carbon metabolism
gob01230  Biosynthesis of amino acids
Module
gob_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gob_M00002  Glycolysis, core module involving three-carbon compounds
gob_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gobs_4605
  Energy metabolism
   00680 Methane metabolism
    Gobs_4605
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gobs_4605
Enzymes [BR:gob01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Gobs_4605
Membrane trafficking [BR:gob04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Gobs_4605
Exosome [BR:gob04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Gobs_4605
  Exosomal proteins of melanoma cells
   Gobs_4605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADB77153
UniProt: D2S4K3
Position
complement(4826169..4826942)
Genome map
AA seq 257 aa AA seqDB search
MTMYSPQTRPGTLVLLRHGESEWNKANLFTGWVDVPLSEKGRGEAARGGELLAEHGLLPQ
VAHTSVLTRAITTAELALAAADRQWIPVKRSWRLNERHYGALQGKDKAATLAEYGEEQFT
VWRRSYSTPPPPIEPGSEYSQDGDARYAVLPPEVRPQTECLADVVVRMLPYWYDAIVPDL
RAGLTVLVAAHGNSLRALVKHLDGMDEDEVVGLNIPTGVPLRYNLDDDLRPTNPGGRYLD
PDAAAAAIEAVKNQGKR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatgtactcgccccagacccgccccggcacgctcgtgctgctccgccacggcgag
agcgagtggaacaaggccaacctgttcaccggctgggtggacgtgccgctgtcggagaag
ggccgcggcgaggccgcccggggcggtgagctcctcgctgagcacggcctgctgccgcag
gtggcgcacacctcggtgctcacgcgggcgatcaccaccgccgagctggcgctggccgcc
gcggaccggcagtggatcccggtcaagcgctcctggcggctcaacgagcggcactacggc
gcgctgcagggcaaggacaaggccgccacgctcgccgagtacggcgaggagcagttcacg
gtctggcgccgctcctacagcaccccgccgccgcccatcgagccgggcagcgagtactcc
caggacggcgacgcgcgctacgccgtgctgccgccggaggtgcgcccgcagaccgagtgc
ctggccgacgtcgtcgtccggatgctgccgtactggtacgacgcaatcgtgcccgacctg
cgcgcggggctgaccgtgctcgtcgccgcgcacggcaacagcctgcgggcgctggtgaag
cacctggacgggatggacgaggacgaggtcgtggggctcaacatccccaccggcgtcccg
ctgcgctacaacctggacgacgacctgcgcccgaccaaccccggtggccggtacctcgac
cccgacgccgcagccgccgccatcgaggccgtcaagaaccagggcaagcgctga

DBGET integrated database retrieval system