KEGG   Geodermatophilus obscurus: Gobs_4798Help
Entry
Gobs_4798         CDS       T01163                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00620  Pyruvate metabolism
gob00630  Glyoxylate and dicarboxylate metabolism
gob01100  Metabolic pathways
gob01110  Biosynthesis of secondary metabolites
gob01120  Microbial metabolism in diverse environments
gob01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Gobs_4798
   00630 Glyoxylate and dicarboxylate metabolism
    Gobs_4798
Enzymes [BR:gob01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Gobs_4798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADB77335
UniProt: D2S5S9
Position
5008604..5010214
Genome map
AA seq 536 aa AA seqDB search
MSTIAGVDGLEITGPMGDRFDEVLTPRALELVVLLHRELNGRRLERLAARQERVRALADG
ASLDFLEETRSIREDDSWRVADPAPGLVDRRVEMTGPTDRKMTINALNSGARCWLADQED
ANSPLWENVVNGPLNLMDSLDRTIDFTSPQGKKYELRPDDELPTIIVRPRGWHLPEKHIT
VDGEQTSGSLVDFALYLAACGQKQIDKGRGPYFYLPKMESHLEARLWNDAFNLAQDHLGI
PRGTIRATCLIETYPAAFEMEEILYELREHSAGLNAGRWDYMFSVIKTFRTRGEEFTLPD
RNSVGMTVPFMRAYTELLVRTCHKRGAHAIGGMSAFIPSKDPEVNEFAFKKITEDKTREA
NDGFDGSWVAHPGMVQAAMDVFDKVLGDKPNQLDNLREDVQVTAAQLLDVKSTPGEATEA
GLRANISVGIQYVESWLRGSGAVGINNLMEDAATAEISRSQVWQWLHNGVRLSNGEPVTR
ELVERLTDEEMQSIAESRGDSFASGRWDDARALFLEMAVADEYSDFLTLPAYERMP
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccatcgccggcgtggacggtctcgagatcaccggccccatgggtgaccggttc
gacgaggtcctcaccccccgggcgctcgagctcgtcgtcctcctccaccgcgagctgaac
gggcggcggctcgagcggctcgccgcgcgacaggagcgggtccgcgcgctggccgacggc
gccagcctcgacttcctcgaggagacccggtcgatccgcgaagacgactcgtggcgggtg
gccgacccggcgcccggcctggtcgaccgccgggtggagatgaccggcccgaccgaccgc
aagatgacgatcaacgcgctgaactccggggccaggtgctggctggccgaccaggaggac
gcgaactccccgctgtgggagaacgtcgtcaacggccctctcaacctgatggactcgctc
gaccgcacgatcgacttcaccagcccgcagggcaagaagtacgagctcaggccggacgac
gagctcccgaccatcatcgtgcgcccccgcggctggcacctgccggagaagcacatcacc
gtcgacggcgagcagacctccggcagcctggtcgacttcgcgctgtacctggccgcctgc
ggccagaagcagatcgacaagggccgcggcccgtacttctacctgccgaagatggagagc
cacctcgaggcgcggctgtggaacgacgccttcaacctggcgcaggaccacctcggcatc
ccccgcggcaccatccgcgccacctgcctgatcgagacctaccccgcggcgttcgagatg
gaggagatcctctacgagctgcgcgagcactccgccggactcaacgccggccgctgggac
tacatgttcagcgtgatcaagacgttccggacccggggcgaggagttcaccctgccggac
cgcaactcggtcggcatgactgtgcccttcatgcgggcctacaccgagctgctcgtgcgg
acctgccacaagcgcggcgcgcacgcgatcggcggcatgtccgcgttcatcccgagcaag
gacccggaggtcaacgagttcgccttcaagaagatcaccgaggacaagacccgcgaggcc
aacgacggcttcgacggctcgtgggtggcccaccccggcatggtgcaggcggcgatggac
gtcttcgacaaggtgctgggcgacaagcccaaccagctggacaacctgcgggaggacgtc
caggtcaccgccgctcagctgctcgacgtgaagtccactcccggcgaggccaccgaggcc
gggctgcgggccaacatcagcgtggggatccagtacgtggagtcgtggctgcgcggctcc
ggcgcggtcggcatcaacaacctcatggaggacgccgccaccgcggagatctcccgcagc
caggtctggcagtggctgcacaacggcgtgcggctctcgaacggcgagccggtcacccgc
gagctggtcgagcgcctcaccgacgaggagatgcagtcgatcgccgagtcccgcggcgac
tccttcgcctccggccgctgggacgacgcccgcgcgctgttcctggagatggccgtggcc
gacgagtactcggacttcctgaccctgcccgcctacgagcgcatgccgtga

DBGET integrated database retrieval system