KEGG   Geodermatophilus obscurus: Gobs_4798Help
Entry
Gobs_4798         CDS       T01163                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
gob  Geodermatophilus obscurus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:gob01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gob00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:gob00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5008604..5010214
Genome map
AA seq 536 aa AA seqDB search
MSTIAGVDGLEITGPMGDRFDEVLTPRALELVVLLHRELNGRRLERLAARQERVRALADG
ASLDFLEETRSIREDDSWRVADPAPGLVDRRVEMTGPTDRKMTINALNSGARCWLADQED
ANSPLWENVVNGPLNLMDSLDRTIDFTSPQGKKYELRPDDELPTIIVRPRGWHLPEKHIT
VDGEQTSGSLVDFALYLAACGQKQIDKGRGPYFYLPKMESHLEARLWNDAFNLAQDHLGI
PRGTIRATCLIETYPAAFEMEEILYELREHSAGLNAGRWDYMFSVIKTFRTRGEEFTLPD
RNSVGMTVPFMRAYTELLVRTCHKRGAHAIGGMSAFIPSKDPEVNEFAFKKITEDKTREA
NDGFDGSWVAHPGMVQAAMDVFDKVLGDKPNQLDNLREDVQVTAAQLLDVKSTPGEATEA
GLRANISVGIQYVESWLRGSGAVGINNLMEDAATAEISRSQVWQWLHNGVRLSNGEPVTR
ELVERLTDEEMQSIAESRGDSFASGRWDDARALFLEMAVADEYSDFLTLPAYERMP
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccatcgccggcgtggacggtctcgagatcaccggccccatgggtgaccggttc
gacgaggtcctcaccccccgggcgctcgagctcgtcgtcctcctccaccgcgagctgaac
gggcggcggctcgagcggctcgccgcgcgacaggagcgggtccgcgcgctggccgacggc
gccagcctcgacttcctcgaggagacccggtcgatccgcgaagacgactcgtggcgggtg
gccgacccggcgcccggcctggtcgaccgccgggtggagatgaccggcccgaccgaccgc
aagatgacgatcaacgcgctgaactccggggccaggtgctggctggccgaccaggaggac
gcgaactccccgctgtgggagaacgtcgtcaacggccctctcaacctgatggactcgctc
gaccgcacgatcgacttcaccagcccgcagggcaagaagtacgagctcaggccggacgac
gagctcccgaccatcatcgtgcgcccccgcggctggcacctgccggagaagcacatcacc
gtcgacggcgagcagacctccggcagcctggtcgacttcgcgctgtacctggccgcctgc
ggccagaagcagatcgacaagggccgcggcccgtacttctacctgccgaagatggagagc
cacctcgaggcgcggctgtggaacgacgccttcaacctggcgcaggaccacctcggcatc
ccccgcggcaccatccgcgccacctgcctgatcgagacctaccccgcggcgttcgagatg
gaggagatcctctacgagctgcgcgagcactccgccggactcaacgccggccgctgggac
tacatgttcagcgtgatcaagacgttccggacccggggcgaggagttcaccctgccggac
cgcaactcggtcggcatgactgtgcccttcatgcgggcctacaccgagctgctcgtgcgg
acctgccacaagcgcggcgcgcacgcgatcggcggcatgtccgcgttcatcccgagcaag
gacccggaggtcaacgagttcgccttcaagaagatcaccgaggacaagacccgcgaggcc
aacgacggcttcgacggctcgtgggtggcccaccccggcatggtgcaggcggcgatggac
gtcttcgacaaggtgctgggcgacaagcccaaccagctggacaacctgcgggaggacgtc
caggtcaccgccgctcagctgctcgacgtgaagtccactcccggcgaggccaccgaggcc
gggctgcgggccaacatcagcgtggggatccagtacgtggagtcgtggctgcgcggctcc
ggcgcggtcggcatcaacaacctcatggaggacgccgccaccgcggagatctcccgcagc
caggtctggcagtggctgcacaacggcgtgcggctctcgaacggcgagccggtcacccgc
gagctggtcgagcgcctcaccgacgaggagatgcagtcgatcgccgagtcccgcggcgac
tccttcgcctccggccgctgggacgacgcccgcgcgctgttcctggagatggccgtggcc
gacgagtactcggacttcctgaccctgcccgcctacgagcgcatgccgtga

DBGET integrated database retrieval system