KEGG   Geodermatophilus obscurus: Gobs_4825Help
Entry
Gobs_4825         CDS       T01163                                 

Definition
(GenBank) PfkB domain protein
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Gobs_4825
Enzymes [BR:gob01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Gobs_4825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase DAP10
Motif
Other DBs
NCBI-ProteinID: ADB77361
UniProt: D2S5V5
Position
5041869..5042801
Genome map
AA seq 310 aa AA seqDB search
MSVTVVGSLNEDVLVRVHRLPGRGETVVGRGTVLAPGGKGANQAAAAGRLGGGVAMVGRV
GDDPAADRQLAALTAAGVDVTAVARTPGVLTGSATIPVEEGSGENLIVVVPGANAELRPG
DVDVAAVRDARVVLLQLEVPLETVQAATAVAAGTVVLTPAPPQPLAADLLARVDVLVPNE
HELVQLAEAAPGDRTPGELAALARTLTGGTVVVTLGGRGALLVPDDGPALLQPPLPVRAV
DTTGAGDAFCGALAVALAAGTAPAEAVATAVTAAAMSTTRPGARDALPDAAAVAAARSGL
PPAVPVDQGG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtcaccgtcgtcggcagcctcaacgaggacgtgctggtccgcgtgcaccgcctg
cccggccgcggcgagaccgtcgtcggccgcgggaccgtgctggcgcccggaggcaagggc
gcgaaccaggcggcggccgccgggcggctcggcggcggggtggcgatggtcggccgggtc
ggcgacgacccggccgccgaccgccagctggcggcgctgaccgctgcaggggtcgacgtc
acggccgtggcgcggacgccgggagtgctcaccggcagtgcgaccatcccggtcgaggag
gggagcggtgagaacctgatcgtcgtcgtccccggcgccaacgccgagctgcgaccgggg
gacgtcgacgtcgcggcggtgcgcgacgcgcgggtggtgctgctgcagctggaggtgccg
ctggagaccgtgcaggcggcgaccgcggtggccgcgggcaccgtcgtcctcaccccggcg
ccgccgcagccgctggcggcggacctgctcgcgcgggtcgacgtcctggtgcccaacgag
catgagctggtgcagctggccgaggcggcccccggggaccggacacccggcgagctggcg
gcgctggcgcgcaccctgacgggcggcacggtcgtggtcaccctcggcgggcgcggcgcg
ctgctggtgccggacgacggcccggcgctgctgcagcctccgctcccggtgcgggccgtc
gacaccaccggtgccggcgacgccttctgcggggcgctcgcggtcgccctcgccgccggc
acggcaccggccgaggcggtggcgacggcggtcacggcggccgcgatgtcgacgacccga
cccggcgcccgggacgcgctgcccgacgccgcagcggtcgccgcggcgcggtccgggctg
ccgcccgccgtcccggtggaccagggcggttga

DBGET integrated database retrieval system