KEGG   Geodermatophilus obscurus: Gobs_4841Help
Entry
Gobs_4841         CDS       T01163                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
gob  Geodermatophilus obscurus
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Gobs_4841
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Gobs_4841
Enzymes [BR:gob01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Gobs_4841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5053274..5054029
Genome map
AA seq 251 aa AA seqDB search
MADSGTLSGRRALVTGGASGIGRACAVRLAEAGADVVVVDRDADAAKAVAEAVGGTAVAV
DLSDLDAVDGLDLDVDVLVNNAGLQHVAPLHEFPVDRFSLILRLMLETPFRLVRSALPHM
YERGWGRVVNVSSVHGLRASAYKSAYVTAKHGLEGLSKVIALEGAPHGVTSNCVNPAYVR
TPLVENQIADQAKAHGLSEDQVVEQIMLAPAAVKRLIEPAEVAEAVAYLCSPAAASITGS
SLVMDGGWTAH
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggcggactcaggaaccctcagcggccggcgggccctcgtcaccggcggcgcctcgggc
atcggccgggcgtgcgcggtgcgactggccgaggccggcgcggacgtggtcgtcgtcgac
cgtgacgccgacgcggcgaaggcggtggccgaagcggtcggggggacggcggtcgccgtc
gacctctccgacctcgacgcggtcgacggcctggacctcgacgtcgacgtgctggtcaac
aacgccgggctgcagcacgtggcaccgctgcacgagttcccggtcgaccgcttctcgctg
atcctgcggctgatgctggagaccccgttccggctggtccggagcgcgctgccgcacatg
tacgagcgcggctggggccgggtggtcaacgtcagctccgtgcacgggctgcgcgcctcg
gcgtacaagagcgcctacgtcaccgccaagcacggcctggaggggctgtcgaaggtgatc
gcactggagggcgccccgcacggggtcacctcgaactgcgtcaacccggcctacgtgcgc
acgcccctcgtggagaaccagatcgccgaccaggccaaggcgcacggcctgtccgaggac
caggtcgtggagcagatcatgctcgccccggcggcggtcaagcggctgatcgagccggcg
gaggtcgccgaggcggtcgcctacctgtgctcgccggcggcggcgtccatcaccggcagc
tccctggtgatggacggcgggtggaccgcccactga

  All links  
No link information was found.   
DBGET integrated database retrieval system