KEGG   Geodermatophilus obscurus: Gobs_4894Help
Entry
Gobs_4894         CDS       T01163                                 

Definition
Peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gob  Geodermatophilus obscurus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Gobs_4894
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Gobs_4894
Enzymes [BR:gob01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Gobs_4894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5107999..5108493
Genome map
AA seq 164 aa AA seqDB search
MSGLLDTPLTTLQGEPTTLRALTRGGAALVVNVASRCGLTPQYTRLEALQREYGARGLTV
VGVPCNQFAGQEPGTAEEIAGFCSATYGVTFPMTEKLDVNGPGAHPLFQRLSEAPDASGE
AGDVQWNFEKFLLDTDGEVVARFRPMTQPDAPEVRHAIEEALHR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcctgctggacacccccttgaccaccctccagggcgagccgaccaccctccgg
gccctgacccgtggcggcgccgccctcgtggtgaacgtcgccagccggtgcggcctcacc
ccgcagtacacccggctggaggcgctgcagcgggagtacggcgcccggggcctcacggtc
gtcggggtgccgtgcaaccagttcgccggccaggagccgggcacggccgaggagatcgcc
gggttctgctcggcgacctacggcgtcaccttccccatgacggagaagctcgacgtcaac
ggcccgggtgcgcacccgctgttccagcggctcagcgaggcgccggacgcctccggtgag
gccggcgacgtgcagtggaacttcgagaagttcctgctggacaccgacggcgaggtcgtg
gcccggttccgcccgatgacccagccggacgcccccgaggtccggcacgcgatcgaggag
gccctgcaccggtga

DBGET integrated database retrieval system