KEGG   Geodermatophilus obscurus: Gobs_4903Help
Entry
Gobs_4903         CDS       T01163                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00010  Glycolysis / Gluconeogenesis
gob00071  Fatty acid degradation
gob00350  Tyrosine metabolism
gob00625  Chloroalkane and chloroalkene degradation
gob00626  Naphthalene degradation
gob01100  Metabolic pathways
gob01110  Biosynthesis of secondary metabolites
gob01120  Microbial metabolism in diverse environments
gob01130  Biosynthesis of antibiotics
gob01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gobs_4903
  Lipid metabolism
   00071 Fatty acid degradation
    Gobs_4903
  Amino acid metabolism
   00350 Tyrosine metabolism
    Gobs_4903
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Gobs_4903
   00626 Naphthalene degradation
    Gobs_4903
Enzymes [BR:gob01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Gobs_4903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 3HCDH_N Methyltransf_11 Methyltransf_25 Met_10 adh_short IGFBP 2-Hacid_dh_C ELFV_dehydrog TrkA_N TPMT
Motif
Other DBs
NCBI-ProteinID: ADB77434
UniProt: D2S6U2
Position
complement(5115512..5116528)
Genome map
AA seq 338 aa AA seqDB search
MRALLFDTYGGPLTVREVPAPDPAPGGVVVRVGASGVCRSDWHAWQGHDPDVVLPHVPGH
ELAGTVAAVGADVRRWRGGDRVTVPFVNACGRCAQCAAGEHQVCTRQTQPGFTHWGSMAE
YVALDAADVNLVALPDGLDAATAAALGCRFATAFRAVVQVARVQPGEWVAVHGCGGVGLS
AVQVAVAAGARVVAVDVSPAALRLAADLGAEHTVAEPAVIPELTAGGAHVSLDALGAAVT
CENSIRCLRPRGRHVQVGLLPPAQGRPAVPMDLVVARELQVLGSHGMAAHTYPALLGLIA
AGRLRPQALVTRQLALDEAGAAIAAVGRDPGIAVVTRF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgcactgctgttcgacacctacggcggcccgctgaccgtgcgggaggtccccgcg
cccgacccggcacccggcggcgtcgtcgtccgggtgggcgccagcggcgtctgccgcagc
gactggcacgcctggcagggccacgacccggacgtcgtcctgccgcacgtgcccgggcac
gagctggccggcaccgtggccgccgtcggggcggacgtccggcgctggcggggaggcgac
cgcgtgaccgtcccgttcgtcaacgcctgcggccgctgcgcccagtgcgccgccggcgag
caccaggtctgcacccggcagacccagcccggcttcacgcactggggctcgatggccgag
tacgtggcgctcgacgccgccgacgtcaacctcgtcgccctccccgacgggctcgacgcc
gccaccgccgccgccctcggctgccgtttcgccaccgccttccgcgcggtcgtccaggtg
gcgagggtgcagcccggcgagtgggtggccgtgcacggctgcggcggggtcgggctctcg
gcggtgcaggtcgcggtggccgccggcgcccgggtggtcgccgtcgacgtctcaccggcg
gccctgcggctggccgccgacctcggcgccgagcacaccgtggcggaaccggccgtgatc
cccgagctgaccgccggcggcgcgcacgtctccctcgacgccctgggtgcggccgtcacc
tgcgagaactccatccggtgcctgcggccgcggggccggcacgtgcaggtcgggctgctg
ccgcctgcccagggccgcccggcggtccccatggacctcgtcgtcgcccgggagctgcag
gtgctgggcagccacggcatggccgcccacacctatcccgccctgctcgggctgatcgcc
gccggccggctgcggccgcaggcgctggtcacgcggcagctcgccctcgacgaggccggc
gccgccatcgctgcggtgggccgcgacccggggatcgcggtcgtcacccgcttctga

DBGET integrated database retrieval system