KEGG   Geodermatophilus obscurus: Gobs_4903Help
Entry
Gobs_4903         CDS       T01163                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
gob  Geodermatophilus obscurus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Gobs_4903
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gobs_4903
  Lipid metabolism
   00071 Fatty acid degradation
    Gobs_4903
  Amino acid metabolism
   00350 Tyrosine metabolism
    Gobs_4903
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Gobs_4903
   00626 Naphthalene degradation
    Gobs_4903
Enzymes [BR:gob01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Gobs_4903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5115512..5116528)
Genome map
AA seq 338 aa AA seqDB search
MRALLFDTYGGPLTVREVPAPDPAPGGVVVRVGASGVCRSDWHAWQGHDPDVVLPHVPGH
ELAGTVAAVGADVRRWRGGDRVTVPFVNACGRCAQCAAGEHQVCTRQTQPGFTHWGSMAE
YVALDAADVNLVALPDGLDAATAAALGCRFATAFRAVVQVARVQPGEWVAVHGCGGVGLS
AVQVAVAAGARVVAVDVSPAALRLAADLGAEHTVAEPAVIPELTAGGAHVSLDALGAAVT
CENSIRCLRPRGRHVQVGLLPPAQGRPAVPMDLVVARELQVLGSHGMAAHTYPALLGLIA
AGRLRPQALVTRQLALDEAGAAIAAVGRDPGIAVVTRF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgcactgctgttcgacacctacggcggcccgctgaccgtgcgggaggtccccgcg
cccgacccggcacccggcggcgtcgtcgtccgggtgggcgccagcggcgtctgccgcagc
gactggcacgcctggcagggccacgacccggacgtcgtcctgccgcacgtgcccgggcac
gagctggccggcaccgtggccgccgtcggggcggacgtccggcgctggcggggaggcgac
cgcgtgaccgtcccgttcgtcaacgcctgcggccgctgcgcccagtgcgccgccggcgag
caccaggtctgcacccggcagacccagcccggcttcacgcactggggctcgatggccgag
tacgtggcgctcgacgccgccgacgtcaacctcgtcgccctccccgacgggctcgacgcc
gccaccgccgccgccctcggctgccgtttcgccaccgccttccgcgcggtcgtccaggtg
gcgagggtgcagcccggcgagtgggtggccgtgcacggctgcggcggggtcgggctctcg
gcggtgcaggtcgcggtggccgccggcgcccgggtggtcgccgtcgacgtctcaccggcg
gccctgcggctggccgccgacctcggcgccgagcacaccgtggcggaaccggccgtgatc
cccgagctgaccgccggcggcgcgcacgtctccctcgacgccctgggtgcggccgtcacc
tgcgagaactccatccggtgcctgcggccgcggggccggcacgtgcaggtcgggctgctg
ccgcctgcccagggccgcccggcggtccccatggacctcgtcgtcgcccgggagctgcag
gtgctgggcagccacggcatggccgcccacacctatcccgccctgctcgggctgatcgcc
gccggccggctgcggccgcaggcgctggtcacgcggcagctcgccctcgacgaggccggc
gccgccatcgctgcggtgggccgcgacccggggatcgcggtcgtcacccgcttctga

DBGET integrated database retrieval system