KEGG   Geodermatophilus obscurus: Gobs_4986Help
Entry
Gobs_4986         CDS       T01163                                 

Definition
(GenBank) formaldehyde dehydrogenase, glutathione-independent
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00625  Chloroalkane and chloroalkene degradation
gob00680  Methane metabolism
gob01100  Metabolic pathways
gob01120  Microbial metabolism in diverse environments
gob01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Gobs_4986
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Gobs_4986
Enzymes [BR:gob01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Gobs_4986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ADB77514
UniProt: D2S722
Position
complement(5198195..5199415)
Genome map
AA seq 406 aa AA seqDB search
MAGNKAVMYMGPGKVEVADLDYPGLELKEGPGVNPANVGRKTPHGVILKTVSTNICGSDQ
HMVRGRTTAPEGLVLGHEITGEIIEKGADVEFLEVGDIVSVPFNIACGRCRNCKEGKTGI
CLNVNPERPGSAYGYVDMGGWTGGQAEYVMVPYADWNCLKFPDRDQALAKIRDLTMLSDI
FPTGYHGCVTAGVGTGSTVYIAGAGPVGLAAAASAHLLGAAVVIVGDLNADRLAQARSFG
CETVDVSQGDPKDQIEQILGEPEVDCGVDAVGFEARGHGKDAEREAPATVLNSLMDITRA
GGALGIPGLYVTGDPGAADEAAKTGSLSIRLGLGWAKSHAFTTGQCPVMRYNRQLMMAIL
HDRVQIAKAVNAEVIPLEDAPRGYQEFDRGAAKKYILDPNGMIPAA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtggcaggcaacaaagcagtcatgtacatggggcccggcaaggtcgaggtcgcggacctg
gactaccccgggttggagctcaaggagggtccgggggtcaacccggccaacgtcggtcgc
aagaccccgcacggggtcatcctgaagacggtcagcaccaacatctgcggcagtgaccag
cacatggtccgcgggcggacgacggcgcccgagggcctggtcctcggccacgagatcacc
ggcgagatcatcgagaagggtgccgacgtcgagttcctcgaggtcggtgacatcgtcagc
gtgcccttcaacatcgcctgcggccgctgtcgcaactgcaaggagggcaagaccggcatc
tgcctgaacgtcaaccccgagcgccccggctcggcctacggctacgtcgacatgggcggc
tggaccggcggccaggccgagtacgtgatggtcccgtacgcggactggaactgcctcaag
ttcccggaccgggaccaggcgctggcgaagatccgcgacctgacgatgctgtcggacatc
ttcccgacgggttaccacggctgcgtcaccgccggggtgggtaccggctcgactgtctac
atcgccggggccggcccggtggggctggcggccgcggcctcggcgcacctgctcggcgcc
gccgtcgtcatcgtcggtgacctcaacgccgaccggctggcccaggcccgcagcttcggc
tgcgagaccgtcgacgtctcccagggcgaccccaaggaccagatcgagcagatcctcggc
gagcccgaggtcgactgcggcgtcgacgcggtcggcttcgaggcccgcgggcacgggaag
gacgccgagcgtgaggcgccggccacggtgctcaactcgctgatggacatcacccgggcc
ggcggcgcgctcggcatcccgggcctctacgtgaccggtgacccgggcgcggccgacgag
gcggcgaagacggggtcgctgtccatccggctgggcctgggctgggcgaagtcgcacgcg
ttcaccaccggccagtgcccggtcatgcgctacaaccgccagttgatgatggcgatcctc
cacgaccgggtgcagatcgcgaaggcggtgaacgccgaggtgatcccgctggaggatgcg
ccgcgcggctaccaggagttcgaccggggcgcggcgaagaagtacatcctcgacccgaac
gggatgatcccggccgcctga

DBGET integrated database retrieval system