KEGG   Geodermatophilus obscurus: Gobs_5003Help
Entry
Gobs_5003         CDS       T01163                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
gob  Geodermatophilus obscurus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:gob00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Gobs_5003
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Gobs_5003
Enzymes [BR:gob01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Gobs_5003
Two-component system [BR:gob02022]
 CheA family
  CheA-CheYBV
   Gobs_5003
Bacterial motility proteins [BR:gob02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Gobs_5003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5219283..5220398)
Genome map
AA seq 371 aa AA seqDB search
MEPIRVLVVDDSVVVRKIVTDVLSEDPAIEVVGTAVNGRIAVGKLEQLKPDLVTMDIEMP
EMNGIEAVRTIRALRSRVPIIMFSTLTERGASATLDALSAGANDYVTKPANVGSVAQSME
SVRQQLIPKIKALTGRPVTTGPVRAAAPAPAPVRPPAPRVGAVKQPAVLVIGSSTGGPEA
LAKVLPTLPASLPVPVLLVQHMPPVFTRQFAQRLDRLCALTVVEAVDGAPLGPGTVHLAP
GDHHLTVRRTARGLFTGLDQAPPENFCRPAVDPLFRSAVEAFDGAVLGVVLTGMGSDGRL
GAGRIRETGGAVVVQDQATSVVWGMPGAVATAGYADEVLPLDRVAEAISRRLAGPRAGTA
GPTPAAVGGRR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgatccgggtgctggtcgtcgatgactcggtggtcgtccgcaagatcgtcacc
gacgtcctctcggaggacccggcgatcgaggtcgtcggcaccgccgtgaacggccgcatc
gccgtcggcaagctggagcagctcaagcccgacctggtcacgatggacatcgagatgccg
gagatgaacggcatcgaggcggtccgcaccatccgtgccctgcgcagccgcgtgccgatc
atcatgttcagcacgctcaccgagcgcggtgcctcggcgaccctcgacgccctctccgcc
ggtgcgaacgactacgtgaccaagccggccaacgtcggcagcgtcgcgcagtccatggag
agcgtccgccagcagctgatccccaagatcaaggcgctcaccgggcgcccggtcaccacc
ggtcccgtccgggccgccgcacccgccccggccccggtccggccgccggccccccgcgtc
ggtgcggtcaagcagcccgccgtcctggtcatcggctcgtccaccggtggcccggaggcc
ctggcgaaggtgctgccgaccctgccggcgtccctgccggtcccggtgctgctcgtgcag
cacatgcccccggtcttcacccgccagttcgcccagcggctggaccgtctctgcgcgctc
accgtggtcgaggccgtcgacggcgccccgctggggccgggcacggtgcacctggccccg
ggcgaccaccacctgaccgtccgccggaccgcccgcggcctgttcaccgggctcgaccag
gcccctccggagaacttctgccgccccgccgtcgacccgctgttccgttccgcggtcgag
gcgttcgacggcgccgtcctgggtgtcgtgctcaccggcatgggctcggacgggcgcctc
ggcgccggccgcatccgcgagaccggaggcgccgtcgtcgtccaggaccaggcgacgtcg
gtggtctgggggatgccgggcgccgtcgccacggccggctacgccgacgaggtgctgccg
ctcgaccgggtcgccgaggcgatcagccggcggctcgccggcccgcgcgccggcactgcc
ggcccgaccccagctgccgtcggaggacgacgatga

DBGET integrated database retrieval system