KEGG   Geodermatophilus obscurus: Gobs_5037Help
Entry
Gobs_5037         CDS       T01163                                 

Definition
(GenBank) peptidase M20
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00300  Lysine biosynthesis
gob01100  Metabolic pathways
gob01120  Microbial metabolism in diverse environments
gob01230  Biosynthesis of amino acids
Module
gob_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Gobs_5037
Enzymes [BR:gob01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Gobs_5037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M42 Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADB77565
UniProt: D2S7Y5
Position
complement(5257821..5258948)
Genome map
AA seq 375 aa AA seqDB search
MTAPVLDVVALVRELVGRTTVSGDAAAQRDVLGTLTDVLRGHAPHLQVIEGRDRDHPWTL
LRTPADPGRRQLLLACHVDTVPAADPGAWQRDPFGADLEEGRVWGRGGSDMKAGVVAAAA
ALATADPGTPVALLLTSDEEIGSKGAAAAAAAVAELPVGAVVVPEATGNQVVLGHKGALW
LAVRTAGRAAHGSTPERGHNAVLDLVAVLGRAGGALPLRSDAFLGTETWNPGVVTGGTVP
NVVPDRAEAVVDMRTVAPGDELLAWWREQPEVADVEVRVDLPPVGTPADDPWVASLPAPA
LPTPATYFTDASVLVQVVGGAPIVVWGPGTPAVMHAVDEYVEVAEVEHAAAAFADVVTRW
NGSPAGSGEPVGGGG
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacggctcctgtcctcgacgtggtcgcgctggtgcgggaactggtcggccggacgacg
gtgtccggcgacgcggccgcccagcgcgacgtgctcggcacgctgaccgacgtgctgcgc
ggccacgccccgcacctgcaggtgatcgaggggcgagaccgggaccacccctggaccctg
ctgcggaccccggccgaccccggccgccggcagctgctgctcgcctgccacgtcgacacc
gtcccggcggccgaccccggagcctggcagcgcgacccgttcggcgcggacctcgaggag
gggcgggtgtggggccgcggagggagcgacatgaaggccggcgtggtcgccgccgcggct
gcgctcgccacggcggaccccgggacccccgtggcgctgctgctcaccagcgacgaggag
atcggctcgaagggcgccgccgccgcggccgcggcggtcgccgagctgccggtgggggcg
gtggtcgtccccgaggcgaccggcaaccaggtggtcctcggccacaagggcgcgctgtgg
ctcgccgtccgcaccgcgggccgcgccgcgcacggcagcacgcccgagcgcgggcacaac
gccgtcctcgacctggtcgccgtcctcggccgggccggtggggcgctcccgctgcggagc
gacgccttcctcggcacggagacctggaaccccggggtcgtcaccggcggcaccgtgccg
aacgtggtccccgaccgcgccgaggcggtcgtcgacatgcggaccgtggcccccggcgac
gagctgctggcctggtggcgggagcagcccgaggtggccgacgtcgaggtgcgcgtggac
ctgccgcccgtcggtacccccgccgacgacccgtgggtggcctcgctgcccgcgccggct
ctgcccaccccggccacgtacttcaccgacgcctcggtgctcgtgcaggtggtcggcggc
gcaccgatcgtcgtgtggggcccgggcacccccgcggtgatgcacgccgtcgacgagtac
gtggaggtcgccgaggtggagcacgccgcggccgccttcgccgacgtcgtcacccgctgg
aacggctctcctgcagggtccggcgagcctgtgggtggcggggggtag

DBGET integrated database retrieval system