KEGG   Geodermatophilus obscurus: Gobs_5042Help
Entry
Gobs_5042         CDS       T01163                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gob  Geodermatophilus obscurus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Gobs_5042
Enzymes [BR:gob01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Gobs_5042
Exosome [BR:gob04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Gobs_5042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5264235..5265752
Genome map
AA seq 505 aa AA seqDB search
MSQYVAAIDQGTTSTRCMIFDHDGAVVSVGQKEHQQIFPRAGWVEHDPDEIWTNTREVVG
QALARGNVGHSDVVAVGITNQRETTVVWDRNTGRPVYNAIVWQDTRTTAIVEQLGALGGG
ADRYKDKVGLPLATYFAGPKVRWILDNVDGARERAERGELLMGTIDSWLIWNMTGGADGG
LHLTDVSNASRTMLMDYRTLAWDADIAEEMGIPTSMLPEIRSNSEEYGRGRKAGFLAGVP
IAGSLGDQQAATFGQVCFTKGMAKNTYGTGNFMLLNTGEEAVPSQNGLLTTLCYQLGDGK
PVYALEGSIAVTGSLVQWVRDNLGMISSAPEIEDQARSVEDNGGAYFVPAFSGLFAPHWR
SDARGAIVGLTRYVNKGHLARAVLEATAYQTREVLDAMNADSGVDLTELRVDGGMVGNEL
LMQFQADILDVPVIRPQIAETTALGAAYAAGLAVGFWSDLDELTAKWAEDKRWEPQMPAE
ERERNYRNWQKAVTKSLDWVDEDVK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtgagccagtacgtggcagccatcgaccaggggaccacgagcacccgatgcatgattttc
gaccacgacggcgccgtggtctcggtcgggcagaaggagcaccagcaaatcttcccgcgc
gccgggtgggtcgagcacgaccccgacgagatctggaccaacacccgcgaggtggtgggc
caggcgctcgcccgcggcaacgtcgggcactcggacgtggtcgccgtcggcatcaccaac
cagcgcgagaccaccgtcgtgtgggaccggaacaccggccggccggtctacaacgcgatc
gtctggcaggacacccgcaccacggcgatcgtcgagcagctcggcgccctcggcggcggc
gccgaccggtacaaggacaaggtcggcctgccgctggccacctacttcgccgggcccaag
gtgcgctggatcctcgacaacgtcgacggcgcccgggagcgggccgagcgcggtgagctg
ctcatgggcaccatcgactcctggctgatctggaacatgaccggcggggccgacggcggg
ctgcacctcaccgacgtctccaacgcctcccgcacgatgctcatggactaccggacgctg
gcctgggacgccgacatcgccgaggagatgggcatcccgacgtccatgctcccggagatc
cggtccaactccgaggagtacggccggggccgcaaggccggcttcctcgccggggtgccg
atcgccggctcgctcggcgaccagcaggcggccaccttcggccaggtctgcttcaccaag
ggcatggccaagaacacctacggcaccggcaacttcatgctgctcaacaccggcgaggag
gccgtcccgtcgcagaacggcctgctcacgacgctgtgctaccagctcggcgacggcaag
ccggtgtacgccctggagggctcgatcgcggtcaccgggtcgctggtgcagtgggtccgg
gacaacctcgggatgatctcgagcgccccggagatcgaggaccaggcccgctcggtcgag
gacaacggcggcgcgtacttcgtgcccgccttctccgggctcttcgcgccgcactggcgc
tccgacgcccgcggcgccatcgtcggactcacccggtacgtcaacaaggggcacctggcc
cgggcggtgctcgaggcgacggcgtaccagacccgcgaggtgctcgacgcgatgaacgcc
gactccggggtcgacctcaccgagctgcgggtggacggcggcatggtcggcaacgagctg
ctcatgcagttccaggccgacatcctcgacgtcccggtgatccggccgcagatcgccgag
acgacggcgctgggcgccgcctacgccgccgggctcgccgtcggcttctggtccgacctc
gacgagctgaccgccaagtgggccgaggacaagcgctgggagccgcagatgccggccgag
gagcgggagcgcaactaccgcaactggcagaaggcggtcaccaagagcctcgactgggtc
gacgaggacgtgaagtag

DBGET integrated database retrieval system