KEGG   Gluconobacter oxydans H24: B932_0122Help
Entry
B932_0122         CDS       T02348                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
goh  Gluconobacter oxydans H24
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:goh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B932_0122
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B932_0122
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    B932_0122
Enzymes [BR:goh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     B932_0122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
123379..124779
Genome map
AA seq 466 aa AA seqDB search
MRYRSTRGDLTADAPNFSDILLAGLAGDGGLYMPETWPKISAQTFREWRALSYADLTAEV
ISLFSEGAIDRDTLRDMARDAYAGFDHAAVAPLCEVEQDLFSLELFHGPTLAFKDMAMQM
LGRLFDHVLTQRNQKVTIVGATSGDTGSAAIEACRGRERLSVVILHPKGRTSEVQRRQMT
TVPDDNILNIAVEGDFDTCQDIVKALFADQPFRDEVSLSAVNSINWARIAAQIPYYVRAA
LALGAPDREVSFSVPTGNFGNVLAAWAARQMGLPIRRLCIGSNRNDILTRFLLENDMSVR
TVEPSLSPSMDIQVSSNFERLLFELLDRNPTRCAAIMKEFRETGRMAVPHDAWTRMKDVF
DGMTLSDEQTSEAMRHFYNESLYLADPHTAIGLAVGKRFQEPGIPMIAAATAHPAKFPDA
VFSATGIRAALPPHLADLFERPERYDTVSSQIAGIQNAVRAHLKSH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcgctaccgatctactcgcggcgacctgaccgccgacgcccccaacttttccgacatt
ctgcttgccggccttgctggagacggcggtctctacatgccggagacatggccaaaaatc
agtgcccagacattccgcgaatggcgtgcactgtcctacgcggacctgacggctgaggtc
atttcccttttctccgaaggtgccattgatcgcgataccctgcgcgatatggcccgcgac
gcttatgcaggcttcgatcatgctgccgtagcgccactttgcgaagttgagcaggatctc
ttctcgctcgaactgttccatggcccgacgctcgccttcaaagacatggcgatgcagatg
cttgggcgtctcttcgatcacgttctgacgcagcgcaaccagaaggtcacgatcgttggc
gccacatcaggcgataccggttcggcggccattgaagcctgccgtggacgtgagcgtctt
tcggtggttatccttcatccaaagggccgcacatcggaagtccagcgtcgccagatgaca
actgtgccagacgacaacattctgaacattgccgtcgaaggtgacttcgatacctgccag
gatatcgtcaaggccctcttcgccgaccagccgttccgggacgaagtctccctgtccgcc
gtcaattccatcaactgggcccgtatcgccgcacagatcccgtattatgtacgggcagcg
ctggctctcggcgcaccagatcgggaagtgtccttctccgttccgaccggcaatttcggc
aatgtgcttgcggcatgggctgcccgtcagatgggcctcccgatccgtcgcctgtgcatc
ggttccaaccgcaatgacattctcacacgtttccttctggaaaacgacatgagtgtccgc
acagtcgagccgagcctgtccccgtcgatggatattcaggtttcgtccaatttcgaacgt
ctgctgttcgagcttctggatcgcaacccgacgcgctgcgccgcgatcatgaaagagttc
cgcgagactggccgtatggccgttccgcacgatgcctggacgcgcatgaaggatgtcttc
gacggcatgacgctcagtgatgagcagaccagcgaagccatgcgtcatttctacaacgag
agcctctatctggctgatccgcacacggcaatcggcctggctgttggcaagcgctttcag
gaacccggcattccaatgatcgccgcagcaacagctcatcccgccaaatttccggatgca
gtcttctcagcgaccggcatcagagctgcccttcccccgcatctggccgatcttttcgaa
cggccagagcgttacgacacggtgagcagtcagatcgctggcattcagaatgcggtccgc
gcccatctcaaaagccactaa

DBGET integrated database retrieval system