KEGG   Gluconobacter oxydans H24: B932_0122Help
Entry
B932_0122         CDS       T02348                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
goh  Gluconobacter oxydans H24
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:goh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B932_0122
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B932_0122
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    B932_0122
Enzymes [BR:goh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     B932_0122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
123379..124779
Genome map
AA seq 466 aa AA seqDB search
MRYRSTRGDLTADAPNFSDILLAGLAGDGGLYMPETWPKISAQTFREWRALSYADLTAEV
ISLFSEGAIDRDTLRDMARDAYAGFDHAAVAPLCEVEQDLFSLELFHGPTLAFKDMAMQM
LGRLFDHVLTQRNQKVTIVGATSGDTGSAAIEACRGRERLSVVILHPKGRTSEVQRRQMT
TVPDDNILNIAVEGDFDTCQDIVKALFADQPFRDEVSLSAVNSINWARIAAQIPYYVRAA
LALGAPDREVSFSVPTGNFGNVLAAWAARQMGLPIRRLCIGSNRNDILTRFLLENDMSVR
TVEPSLSPSMDIQVSSNFERLLFELLDRNPTRCAAIMKEFRETGRMAVPHDAWTRMKDVF
DGMTLSDEQTSEAMRHFYNESLYLADPHTAIGLAVGKRFQEPGIPMIAAATAHPAKFPDA
VFSATGIRAALPPHLADLFERPERYDTVSSQIAGIQNAVRAHLKSH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcgctaccgatctactcgcggcgacctgaccgccgacgcccccaacttttccgacatt
ctgcttgccggccttgctggagacggcggtctctacatgccggagacatggccaaaaatc
agtgcccagacattccgcgaatggcgtgcactgtcctacgcggacctgacggctgaggtc
atttcccttttctccgaaggtgccattgatcgcgataccctgcgcgatatggcccgcgac
gcttatgcaggcttcgatcatgctgccgtagcgccactttgcgaagttgagcaggatctc
ttctcgctcgaactgttccatggcccgacgctcgccttcaaagacatggcgatgcagatg
cttgggcgtctcttcgatcacgttctgacgcagcgcaaccagaaggtcacgatcgttggc
gccacatcaggcgataccggttcggcggccattgaagcctgccgtggacgtgagcgtctt
tcggtggttatccttcatccaaagggccgcacatcggaagtccagcgtcgccagatgaca
actgtgccagacgacaacattctgaacattgccgtcgaaggtgacttcgatacctgccag
gatatcgtcaaggccctcttcgccgaccagccgttccgggacgaagtctccctgtccgcc
gtcaattccatcaactgggcccgtatcgccgcacagatcccgtattatgtacgggcagcg
ctggctctcggcgcaccagatcgggaagtgtccttctccgttccgaccggcaatttcggc
aatgtgcttgcggcatgggctgcccgtcagatgggcctcccgatccgtcgcctgtgcatc
ggttccaaccgcaatgacattctcacacgtttccttctggaaaacgacatgagtgtccgc
acagtcgagccgagcctgtccccgtcgatggatattcaggtttcgtccaatttcgaacgt
ctgctgttcgagcttctggatcgcaacccgacgcgctgcgccgcgatcatgaaagagttc
cgcgagactggccgtatggccgttccgcacgatgcctggacgcgcatgaaggatgtcttc
gacggcatgacgctcagtgatgagcagaccagcgaagccatgcgtcatttctacaacgag
agcctctatctggctgatccgcacacggcaatcggcctggctgttggcaagcgctttcag
gaacccggcattccaatgatcgccgcagcaacagctcatcccgccaaatttccggatgca
gtcttctcagcgaccggcatcagagctgcccttcccccgcatctggccgatcttttcgaa
cggccagagcgttacgacacggtgagcagtcagatcgctggcattcagaatgcggtccgc
gcccatctcaaaagccactaa

DBGET integrated database retrieval system