KEGG   Gluconobacter oxydans H24: B932_0210Help
Entry
B932_0210         CDS       T02348                                 

Definition
alcohol dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
goh  Gluconobacter oxydans H24
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:goh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B932_0210
  Energy metabolism
   00680 Methane metabolism
    B932_0210
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B932_0210
Enzymes [BR:goh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     B932_0210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
213486..214679
Genome map
AA seq 397 aa AA seqDB search
MSDENRGVVYLGPNHVEVQRIDDPRMETPDGRKIDHGVILKVVSTNICGSDQHMVRGRTT
APSGLVLGHEITGEVIETGSDVEMVRKGDLVSVPFNVACGRCRCCREQHTGVCLTVNSSR
AGGAYGYVDMGGWVGGQARYVMVPYADFNLLRFPDKAQALERIRDLTMLTDILPTGFHGA
INAKVGVGSTVYIAGAGPVGMAAAASARILGAAIVMIGDFNPERLAHAQAVGFEPINLQN
HDRLGDLIEQVIGTPEVDSFIDAVGFEAKGYDGKEQPAVILNQAMEVTRPAGAIGIPGLY
VTEDPGAHEAAAQKGNLTLRLGQGWAKSQSFHTGQTPVLRYNRQLMQAILHGRLPIADIV
NATVISLEDAPRGYHDFDNGAPRKFVLDPHGMLKNAA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgaaaacagaggggtcgtttatctcggccccaatcatgttgaagtccagcgg
atcgatgaccccagaatggaaacacccgatggccggaagattgaccacggcgtcattctc
aaggtcgtctccaccaatatctgcggctccgaccagcatatggttcgaggccgcacaaca
gcgccgtccgggctggtcctcggccacgaaatcactggcgaagtcatcgaaaccggatcg
gatgtcgagatggtccgcaagggcgatctggtttccgttcccttcaacgtcgcctgtggg
cgatgccgatgctgccgcgagcagcacacgggcgtatgtctgactgtcaactccagtcgt
gcgggcggcgcatatggttatgtggatatgggcggctgggttggcggacaggcgcgctac
gtcatggtcccttacgccgatttcaatctgctgcgcttccctgacaaggctcaggctctt
gagcgcatcagagacctcaccatgctgaccgatattcttcccaccgggttccatggcgcc
atcaacgccaaggtgggtgtgggatcaacggtctatatcgcgggtgccgggccggttggt
atggcagcggcagcgtcggcgcgcattctcggcgccgccattgtcatgattggcgatttc
aatcctgaacgcctcgcccacgcgcaagcggtcgggtttgagcccatcaacctccagaac
cacgacaggctcggtgacctcatcgaacaggtcatcggaacaccggaggtcgacagcttc
attgatgccgtcggtttcgaagccaagggatatgacggaaaggaacaaccagccgtcatc
ctcaaccaggccatggaagtcacacgcccagccggagccatcggtatcccgggcctgtat
gtgacggaagatccgggcgctcatgaagctgcggcccagaaaggaaacctgacgctccga
ctgggtcagggctgggccaaaagccagtcgttccacaccggccagacccccgtcctgcgt
tataaccgtcaactgatgcaggccattctgcatgggcgccttcccatcgccgacatcgtc
aacgccaccgtgatttcactcgaagacgcaccacgcggctaccatgacttcgacaacggc
gcgccgcgcaaattcgttctcgatcctcatggaatgctgaaaaacgcagcctga

DBGET integrated database retrieval system