KEGG   Gluconobacter oxydans H24: B932_0237Help
Entry
B932_0237         CDS       T02348                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
goh  Gluconobacter oxydans H24
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:goh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B932_0237
  Amino acid metabolism
   00300 Lysine biosynthesis
    B932_0237
Enzymes [BR:goh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     B932_0237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(241935..243080)
Genome map
AA seq 381 aa AA seqDB search
MSSPSFPTDPVALAQDLIRCQSVTPADDGAQALLASVLEKMGFEVTHLPFGPEDAPTPNF
YARIGTGSPSLCFAGHTDVVPPGEGWAHDPFSAEIHDGRLYGRGIADMKGGVACSVAAIA
RFLESRPLKGTISLLITGDEEGPAHFGTKPVIEWLAAHGEVPDFCLLGEPTNPAALGDTI
KIGRRGSMNAEITVRGVQGHVAYPHLADNPIHRLLAALTELTGRCLDEGTEWFSPSSLQV
TSVDVGNPATNVIPADARARLNIRFNDSHTGAGLADWIRDVVSRHAPDSDVKIAISGEAF
LTQPGPAVNCLEQAVQDVTGRRPKLDTGGGTSDARFISQHCAVAEFGLVGATMHKRDEHV
DVSTLEDLTRIYLTFMERFGL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccccgtcttttccgactgatcctgttgctcttgcgcaggatctgatccgttgc
cagtccgtcacgccggccgatgatggagcgcaggctcttctggcatcggttctggaaaag
atggggtttgaggttacgcatcttccttttggaccagaagatgcgccgaccccgaatttt
tatgcccggatcggaacagggagcccgtctctctgtttcgcagggcatacggatgttgta
ccccccggtgaaggctgggcgcatgatccgttctccgccgaaatccatgatggccgcctc
tatgggcgtggcattgcggacatgaaggggggcgtggcctgctccgttgcagctattgct
cgctttttggaaagccgtccgctcaagggaacgatttctcttctcattacgggcgatgaa
gaaggcccggcgcattttggcacaaagcccgtcatcgaatggttggcggcgcatggtgag
gttccggatttctgccttctgggtgagccgaccaatcctgcggctctcggcgacaccatc
aagattggccgtcgcggcagcatgaatgccgagattaccgtgcgtggcgtgcaagggcat
gtggcctatccccatctggcggataatcccatacatcgccttctggcggccctgactgaa
ctgacagggcgttgtcttgatgaagggacggaatggttttctccgtcgtcgcttcaggtg
acgagtgtggatgtcgggaacccagccacgaatgttattccggccgatgcgcgtgcgcgg
ctgaacatccggttcaatgatagccatacgggagccggtctggctgactggatccgggac
gttgtgagccgtcatgcgccggacagcgacgtgaagattgccatcagtggcgaggcattt
ctgacgcagcctgggccagcggtgaactgtcttgagcaggctgttcaggatgtcacgggg
cgtcgcccgaagcttgatacgggtggcggaacgtccgatgcccgtttcatctcgcagcac
tgtgctgttgcagagtttgggctggtgggtgcaaccatgcacaagcgggacgagcacgtg
gatgtttcgacacttgaagacctgacccgtatctatctgacgttcatggaaagatttggc
ttgtga

DBGET integrated database retrieval system