KEGG   Gluconobacter oxydans H24: B932_0352Help
Entry
B932_0352         CDS       T02348                                 

Definition
RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
goh  Gluconobacter oxydans H24
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:goh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    B932_0352
Enzymes [BR:goh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     B932_0352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(360115..360717)
Genome map
AA seq 200 aa AA seqDB search
MIGQLTGLVGQIEGERCIVDVNGVGYVVSASTRTLGTVPHPPEVARLLIETVVREDAILL
YGFGTADEREWFRLLTTVQGVGAKVALAILSANSPGEILLAINAGDRGSLTRAAGVGPRL
ADRILSELRNKVAKMPDGGAAAPMPGIVTGPSVENDALLALAGLGFRRAEAWPVLSRVLA
ENENASLDLAIRLCLKELAR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacaactgactggccttgtcgggcagattgaaggcgagcgctgcatcgtagac
gtcaatggtgttggttatgtcgtgtctgcctcaacgcgcacgctcggcacggttccgcac
ccgccggaagtggcgcgtttgctgattgagaccgtggtgcgggaagacgcgatcctgctg
tatgggttcgggactgccgacgagcgagaatggttccgtctgctaacgactgttcagggc
gtgggcgccaaggttgcgctggctattctgtcagctaattccccgggtgaaattctgctg
gccattaatgccggggaccgtggatctttgacacgtgctgctggtgtcgggccacgcctt
gcggaccgtattctgagcgaactgcgcaacaaggttgccaagatgccagatggcggagct
gctgcgccgatgccggggatcgtgaccgggccaagcgttgagaatgatgcgctgctggcg
ctggcaggtcttggcttccgtcgagcagaggcatggccggtgctgagtcgtgttctggct
gaaaacgagaacgccagccttgatctggccatccgtctttgcctgaaggaactggcccga
tga

DBGET integrated database retrieval system