KEGG   Gluconobacter oxydans H24: B932_0484Help
Entry
B932_0484         CDS       T02348                                 

Definition
chemotaxis protein CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
goh  Gluconobacter oxydans H24
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:goh00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    B932_0484
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    B932_0484
Enzymes [BR:goh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     B932_0484
Two-component system [BR:goh02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   B932_0484
Bacterial motility proteins [BR:goh02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    B932_0484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(490937..491992)
Genome map
AA seq 351 aa AA seqDB search
MFGGHKIYSETISVLVVDDSLTSRALITLALKRNPKIKVVGTAGTPLEAKDLILKLKPDV
LTLDVEMPGMNGLQFLEKIMRLRPMPVVMVSSLLAARSEMVEMACRLGAVECFSKSSGEQ
GEAVFVGLADVVVRAASQRVNAHLGVSTGFSGSSDFIVAIGASTGGVEALGEVLGSFPED
CPPTVIVQHMPQQFSKNFARRLNSISRPEVCLATDGCKLARGKVFIAPGGEMHTEVSRTG
RMSPYSCHLVSGPPLNGHRPSVDALFFSVAQAAGRHAVGVILTGMETDGARGLLAMRQSG
ARTIGQDRNTSIIYGMPKAAFECGAVEVQLPLSEIGPSVLRLAENRTQESH
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgtttggcggccataagatttattccgaaaccatttctgtattggttgttgatgactct
ttgacaagtcgagcgcttataacgcttgcgcttaagcggaaccctaaaatcaaagttgtt
ggaacagcgggtacgccacttgaagctaaggacctgattttaaagcttaagcccgacgtg
ttgacgttagatgttgaaatgcccggaatgaatgggttgcagtttctggaaaagattatg
cgtctgaggcccatgcctgttgtcatggtgtctagtcttctggcggctcgcagcgaaatg
gttgaaatggcctgtcgactgggagctgtagaatgtttttccaaatcgtccggtgagcaa
ggtgaagctgtttttgtgggtttggcagacgtggttgttcgtgcggcctctcaacgtgtc
aatgctcatctgggtgtctcgaccggcttttcgggcagctctgactttatagttgcaatc
ggcgcttcaacgggaggagttgaggcactcggagaagtgctaggaagttttccggaagat
tgccccccgacagtgattgtgcagcatatgccgcagcaattttctaaaaattttgcccgg
cgtctcaattcaatttcacgtccagaagtttgtctcgcgacagatggatgcaagcttgcc
aggggaaaagtatttattgctcccgggggcgagatgcacactgaagtatcccgcacggga
cgtatgtctccttatagttgtcatcttgtgtccggtcctcctctcaatggacatcgtccc
tctgtggacgccctgtttttttcagttgcccaagcggcaggacggcatgctgtaggtgtc
attcttacagggatggagactgatggtgctcggggcttgctggccatgaggcagagtggt
gcacgaactatcgggcaggatcgcaacacgtcaatcatctacggcatgccaaaggctgcc
tttgaatgtggagctgtagaagtgcagttgccgctgtctgaaataggaccatcagtcctt
cgtcttgctgaaaatcgtactcaggagagtcattaa

DBGET integrated database retrieval system