KEGG   Gluconobacter oxydans H24: B932_0500Help
Entry
B932_0500         CDS       T02348                                 

Definition
folate synthesis protein
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
goh  Gluconobacter oxydans H24
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:goh00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(503449..504357)
Genome map
AA seq 302 aa AA seqDB search
MPSQGERMISAPLTSVFVRDLCLFGYHGVLPEENRVGQRFIIDIEIRANLSGAIEGDDYL
QAVCYGTLCDIAAEIVTGKPMGLIEALAGRIADEILARLDRVEVVLVTVHKPSAPVPYPV
SETATIVTRHRIHDVAFSLGANLGEREVTLNAALDRLSMEEGLEITDVSSLYDSAPWGGI
DQPAFVNLCAVGRTTLAPHALLRLCKALEGELGRIPGLRWGARAVDIDLLYYDDRSLSDR
VLTVPHRHLFERAFVLEPLAEIAPERLIGGRRVADALAVLPRIRGDVIRRGPGQAASGNE
GA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgccttctcaaggagaacgcatgatttcggctcctctgacctccgttttcgtgcgggac
ctgtgtctgtttggctatcatggggttctgccggaagagaaccgtgttgggcagcggttc
atcattgatattgagatccgggccaacctgtcaggtgcaattgagggtgacgactacctt
caggccgtctgttacgggacactctgcgatattgctgcggaaattgtcactggaaagccg
atgggccttatcgaggcgctggctggacggattgctgacgaaattctggctcgtctggac
cgggttgaggttgtgcttgtgactgtccacaagccctctgctccagtgccgtatccggta
tccgaaacagcgacgattgtgacgcgtcacaggattcatgatgtggcgttctctctgggc
gccaatcttggagagcgcgaagtcaccctgaatgcagcgctggatcgcttgtccatggaa
gaggggttggagatcacggatgtatcttccctctatgacagcgcgccgtggggtgggatc
gatcagccggctttcgtcaatctctgtgctgtgggccgcacgacgctggcccctcatgct
ctgctcaggctctgcaaggcgcttgagggagagctgggccgcattccgggactgcgatgg
ggggcacgggcagtggatattgacctgctgtattatgacgatcgcagcttgtccgaccgt
gtcctgacggtgcctcaccggcacctttttgagcgggctttcgtgctggagccgctggca
gaaatcgcgccggagcggctgattggtggacgccgggtggcggacgcgctagcagtcctg
cctcgcatccgcggagatgtgatccggcgtggtccgggtcaagccgcgtcggggaacgaa
ggagcctga

DBGET integrated database retrieval system