KEGG   Gluconobacter oxydans H24: B932_0612Help
Entry
B932_0612         CDS       T02348                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
goh  Gluconobacter oxydans H24
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:goh00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    B932_0612
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    B932_0612
Enzymes [BR:goh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     B932_0612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(611180..613327)
Genome map
AA seq 715 aa AA seqDB search
MTRPSSFPNGSFWKKACLGAVLLAGTAFGGMAQAAPVLMPVPQTVSASNGVSPLSGGVRI
VWDAQPSPLLQRAAARFTTRLDAIAGAAGHGASYVLHISAGHDPAYLTTSTKEHYALTTS
ADGAHLEADGPAGVVYGLATFLQLVRQTSDGAVVERLHIDDAPRFAWRGLLLDVSRHFAS
VETVKRQLDAMELLKLNVLHWHLNDGTGFRVESHVFPKLTSVGSHGQYYTQAEIRDVVAY
AADRGIRIVPEFDVPGHALAVLQAYPELAAQPLPDVNAVGENLNNPAMDPTNPKTLKFIR
ALYAEMETLFPDHYFHSGGDEVLGTQWTNNPKIAAYMKAHGYADAPALQAAFTAQVEKVL
SSQGRVMMGWDEVSEAPIPKNVVVEGWRGSKWTGSATRAGHPVVVSSGYYLDLLTPSRTH
YAVDPYDTKANGITPAELEETHPKITPLLQAFLQDPNAAPLTDDQKKMVLGAEGALWTEV
VSEDMLDARLWPRTAALAERFWSSESVRDVDDLERRLPVIMAELQATGLQATQHENALKE
GLAPGHTGPLSTLLSATVPVRNYALNRLASKSGDAMLSAPVAIADPDAFEATRFNSMVKR
YLAGEKSLKAPLKAMLTAWSSNDEAFSAIAKDVPALEEVTPVSHTVAALSNAGLNVLNGA
SGTAWRLDAQHLIAAQDEFFHNSSNHILSLKSEQPPGGLLIAILPGIKALVESHN
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgacccggccctcctctttccctaacggttctttctggaaaaaagcatgtctgggtgcc
gttctcctggctggtacggcctttggcggaatggcgcaggcagctccagtactgatgcca
gtgcctcagacagtctctgcttccaatggcgtcagccctctttccgggggtgtccggatt
gtctgggatgcgcagccctctccactcctgcaaagagctgcggcccgtttcacgacgcgg
cttgacgctattgcgggggccgcagggcacggcgcgtcttatgttctccatatcagtgct
ggtcatgatccggcctatcttaccacgtcgaccaaagagcattatgctctgaccacctcg
gctgacggcgcgcatcttgaggctgatggtccggcgggtgttgtttacggcctggcgaca
ttccttcagcttgtgcgtcagacgtccgatggggcggtcgtagagcgactgcatattgat
gatgccccacgctttgcatggcgtggtcttctgctggacgtttcccgtcattttgcttct
gtagagaccgtcaagcgccagcttgatgccatggagctgctgaagctcaacgtgctgcac
tggcatctgaatgatggcacgggcttccgtgtggagagtcatgtcttcccgaagctgacc
agtgttggatcacacggacagtattatacgcaggccgagatccgggatgttgtggcgtat
gctgcggatcgcggtatccgcattgttccggagtttgatgttcccggtcatgcgctggct
gttctgcaggcctatccggaactggcagcccagccgctgccggacgttaatgccgtgggt
gaaaacctgaacaacccggctatggacccgaccaatcccaagacgctgaaattcattcgc
gcgctctatgcggaaatggagacgctcttccctgaccattacttccattcgggcggtgat
gaggttctgggaacgcagtggacgaataacccgaagattgcggcctacatgaaggcacat
ggttacgcggatgctccggctcttcaggcggcgttcacggcgcaggtcgagaaggtcctg
tccagccagggacgtgtcatgatgggttgggatgaggtcagtgaagccccaattccgaag
aatgttgtcgtggaagggtggcgcggttccaaatggactggttctgccacgcgggctggc
catccggttgtggtgtcttcgggttattatctggatctgctgacgccatcgcgcacgcat
tatgcggtcgatccgtatgacacgaaggcaaatggcattacgccggcagaactggaagaa
actcatccgaagatcaccccactgcttcaggccttccttcaggacccgaatgcagcccct
ctgaccgacgatcagaagaaaatggttctgggtgcagaaggcgcgttgtggacggaagtc
gtgtccgaagacatgctggatgcccgtctgtggcctcgtacggcagctctggccgagcgg
ttctggtcttctgaaagcgtgcgggatgtggatgatctggagcggcgcctgcccgtcatt
atggcggaactccaggcaacgggtttgcaggccacgcagcatgaaaatgctctgaaagaa
gggttggctccgggacataccggcccgctttctacgcttctgagtgctacggttccggta
cggaactatgcgctgaaccgtctggcatccaagagtggagatgcgatgttgtcagctccg
gtggcgattgccgatccggatgcgtttgaggccacgcgtttcaacagcatggtcaagcgg
tatctggcgggtgaaaagagcctgaaagccccactgaaagccatgctgacggcctggtcc
tccaatgatgaagccttttccgctattgccaaggacgtgccagctcttgaagaggtaacg
cctgtctcccatacggttgcggcgctttccaatgctggactgaatgttctgaacggtgct
tcgggaacggcctggcgtctggatgcgcagcatctgatcgcggcacaggatgagttcttc
cacaattcgtcgaaccacatcctgtccctgaagagtgagcagccaccaggtggtctgctg
attgccattttgccgggcatcaaggcgctcgtcgaaagccacaactga

DBGET integrated database retrieval system