KEGG   Gluconobacter oxydans H24: B932_0642Help
Entry
B932_0642         CDS       T02348                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
goh  Gluconobacter oxydans H24
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:goh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(646722..647318)
Genome map
AA seq 198 aa AA seqDB search
MMISNDIEQLISMLSRLPGLGPRSARRAALSLLRQPEARMLPLAHLMERAATSVRTCSLC
GNLDTVDPCHICTDAHRDRGLVCVVETVGDLWALERAGVHRGVYQVLGGTLSALAGLGPD
DLNVASLLDRIAEGGVREVILALGATVEGATTAHWLQEKLAPTDVTVSRVGHGVPMGGAL
DVLDDGTLAAALIARRAL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcagcaatgacatcgaacagctgatttccatgctgtcccgtctgccgggactt
gggccacgttccgcgcggcgggctgccctcagcctgctgcgccagccagaggcccggatg
ctgcctctggcgcatctcatggagcgggcggcaaccagtgtgcggacctgctcgctctgc
ggcaatctcgatacggtcgatccctgtcatatctgcacggatgctcaccgtgatcgcggt
ctggtctgtgttgttgagactgtcggtgatctctgggcgctggagcgggccggagtgcat
cggggcgtctatcaggttctgggaggcacgctttcggcgctcgcagggcttgggccggat
gatctgaatgtcgcgtctttgctggatcgtattgccgaaggtggcgtgcgggaggtcatt
ctggcccttggcgcgactgttgagggtgcaacaacggcgcactggcttcaggaaaaactt
gctccgacggatgtgacggtcagccgtgtcggtcatggtgttccgatgggtggggcgctg
gatgtgctggatgatggtacgctcgccgctgccctgattgcacgacgggccttatga

DBGET integrated database retrieval system