KEGG   Gluconobacter oxydans H24: B932_0742Help
Entry
B932_0742         CDS       T02348                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
goh  Gluconobacter oxydans H24
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:goh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B932_0742
Enzymes [BR:goh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     B932_0742
Exosome [BR:goh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B932_0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
758604..760805
Genome map
AA seq 733 aa AA seqDB search
MLARTVNSALQSMIDALMNGQCGDPFALLGRHRDNRQDIVRVFYPDAVEVHLMVEQSSGQ
TIEKIMRRIDDRGLYSATLPRSARYHLRIRWADAWQETHDPYSFDLLLGDMDLYLFSEGK
HQQIDRMMGAIPMTVDGVSGVRFAVWAPNARRVSVVGDFNIWDGRRHCMRLRHGSGVWEL
FIPGVQAGERYKYEIVSHSGKVLPAKADPYAKAAELPPANASVIAPPDAFEWHDDDWMTA
RHIRQASTAPLSIYEIHAPSWRHPQHGHDIISWDELGDTLIPYLQELGFTHLELLPIAEY
PYSGSWGYQPLSLYAPTVRHGSRAQFARFVDRCHQASLGVIIDWVPAHFPADQHGLSQFD
GTHLYEHADPQEGYHQDWHTLIYNYGRNEVCGFLAGSALHWLEQFHIDGLRVDAVASMLY
RDYSRKNGEWRPNIHGGRENLEAVNFLHHLSETLHGLHPDTLLIAEESTSWPGVTAPART
GGLGFDYKWNMGWMHDTLRYMERDPLWRGYHPSDLTFGMVYAYSECFILPLSHDEVVHGK
GSLLAKMPGDDWQKHANLRAFYALMWAYPGRKLLFMGGELAQPQEWDHEGELAWYRLSDH
YGRGVHDTISSLNRLYQHLPALHALEDSYEGFRWIIADDTQNAVFAWLRQAPGSPPVLVV
GNMTPVPRMDYRIGVPWGGVWRELLNTDAQALGGSNLGNQGQVHAQDIPAHGMAQSVVLT
LPPLAVLYLSPAS
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctcgtacggtcaactctgcactgcaatccatgattgacgctcttatgaatggc
cagtgcggagaccctttcgcattgttgggacggcaccgtgacaatcggcaggacattgtc
agggtcttctatcctgatgccgtggaagttcatctgatggtggagcagtcgtccgggcaa
accattgaaaaaatcatgcgccgcattgatgaccgtgggctgtactcggcaacactgcca
cgctcggcgcggtatcatcttcgcatccgctgggcagacgcctggcaggaaactcatgat
ccctacagctttgatctgctgctcggagatatggatctttatctgttttccgaaggaaag
catcagcagattgaccgtatgatgggcgccattccgatgactgtggatggtgtgtcaggc
gttcgttttgcagtctgggcacccaatgcccgacgtgtttctgttgttggtgatttcaac
atctgggatggccgaagacactgcatgcgtctccgtcacggatcaggcgtctgggaactt
ttcattcctggcgtgcaggctggagaacgatacaagtacgaaatagtatcccattccgga
aaagtgcttcctgccaaggctgatccttacgcaaaggccgccgaactgccacctgcaaac
gcctccgttattgctcccccagatgcgttcgagtggcatgatgacgactggatgaccgct
cgccatattcggcaggccagtacggcccctctttcaatctatgaaattcatgccccttcc
tggcgccacccgcagcacggtcatgacatcatcagctgggatgaactgggggatacgctc
atcccgtatcttcaggaactgggctttacacatctggaactccttccgatagcggaatat
ccctattccggctcctggggataccagccgctgagcctctatgccccgacggtgcgccat
ggatcgcgtgcgcaattcgcgcggtttgtggatcggtgccatcaggcaagtctgggcgtc
attattgactgggttcctgcgcatttcccggccgatcagcacggtctcagccagttcgat
gggacacatctgtacgaacatgccgacccgcaggaaggctatcatcaggattggcacacg
ctaatttacaattatggacgcaatgaggtctgcggttttctggcaggcagcgcccttcac
tggctggaacagttccatatcgacggtctgcgcgtcgatgccgtcgcgtccatgttgtat
cgggactacagccgcaaaaatggagaatggcgccccaacattcatggtggccgcgaaaat
ctcgaagccgtcaatttcctgcaccatctctctgaaacacttcatggcctgcacccggac
acactcctgattgctgaggaatcaacgtcctggcccggtgtaaccgcaccagcgcggaca
ggtggtctcgggttcgattacaagtggaacatggggtggatgcatgacacgctgcgctat
atggagcgcgatccgctctggcggggataccatccctcggacctcacattcggcatggtt
tacgcctattctgagtgttttattttgcccctttcccatgacgaggttgttcatggaaaa
ggatcccttctggccaagatgcccggggatgactggcaaaaacatgccaatcttcgtgca
ttttacgccctgatgtgggcctatccgggccgcaaactcctgttcatgggaggggaactc
gcccagccacaggaatgggatcacgaaggagaactggcctggtatcgactgtccgaccat
tacgggcgcggtgttcatgacacgatcagctctctgaacagactttatcagcacttacca
gccctccacgcccttgaggacagctacgaaggttttcggtggatcatcgcggatgacacc
cagaacgctgtttttgcatggcttagacaggctcccggatcgccaccagttctggttgtc
ggaaacatgacgccagttcctcgcatggactaccgcattggcgttccgtggggcggtgta
tggcgggaattgctcaataccgatgcacaagccctcggcggtagcaatcttggcaaccag
gggcaggtccatgcgcaggatattcccgctcatggcatggcacagtccgtcgttctgaca
ctgccgccactggccgttctctatctttctcccgcctcctga

DBGET integrated database retrieval system