KEGG   Gluconobacter oxydans H24: B932_0857Help
Entry
B932_0857         CDS       T02348                                 

Definition
protein PyrB
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
goh  Gluconobacter oxydans H24
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:goh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    B932_0857
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B932_0857
Enzymes [BR:goh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     B932_0857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
885368..886309
Genome map
AA seq 313 aa AA seqDB search
MPERPSVPRHLLGIEGLTAGQITPFLDLAESYALLSRSRSAPREALRGRTVINLFFEDST
RTRTSFELAGKRLGADVINMTVATSSVNKGETLLDTASTLNAMRCDLLVVRHAQSGAPAL
LSQKVEASVVNAGDGTHEHPTQALLDALTIRRHFGRLEGLTIAICGDVGHSRVARSNIHL
LTALGNSVRLVGPPTLLPSAMTELGNVTLYSDMDEALKGADVVMSLRLQKERMGAGLVPS
SREYFRFFGLDRRRLALANPGALVMHPGPMNRGVEIASDVADSDQSVIAEQVEMGVAVRM
AVLDRLSRARMPL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgagcggccatccgtcccccggcatctgctgggaatcgaggggctgacggcgggg
cagatcaccccgttcctcgatctggcggagagctatgcgctcctgagccgttcccgttcc
gcaccgcgtgaagcgttgcggggccggacggtcatcaatctgttctttgaagacagcacc
cggacccgcaccagtttcgaactggcaggcaagcgccttggggcggacgtcatcaacatg
acggtcgccaccagttcggtgaacaagggtgagaccctgctggacacggcctccacgctg
aatgccatgcgctgcgatcttctggtcgtgcgtcatgcgcagtcgggcgcgccggccctg
ttatcccagaaagtcgaagccagcgttgtgaacgccggagacggcacacatgaacatcct
acgcaggccctgctggacgctttgaccatccggcgccatttcgggcgtctggagggtctg
accatcgcaatctgcggggacgttggtcacagtcgcgtggcacgttccaacatccacctt
ctgaccgcactgggaaactcggtgcgtctggttggcccaccgacgctgctgccatccgct
atgacagagcttggcaatgtcacgctgtattcagacatggatgaagccctgaaaggcgcg
gatgtcgtgatgtccctgcgccttcagaaagagcgcatgggagccggtctggtgccaagt
tcccgagagtatttccggttcttcgggctggaccgccgtcgtctggcactggcaaacccc
ggtgcgctggtcatgcatcccggccccatgaaccggggcgtcgagattgcatccgatgtc
gcggattcggatcagagcgtaatcgccgaacaggtggaaatgggcgtggctgtgcgtatg
gccgttctggatcgcctgtcccgggcacggatgccactatga

DBGET integrated database retrieval system