KEGG   Gluconobacter oxydans H24: B932_1057Help
Entry
B932_1057         CDS       T02348                                 

Definition
(RefSeq) dihydrolipoamide succinyl transferase (E2) of 2-oxoglutarate dehydrogenase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
goh  Gluconobacter oxydans H24
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:goh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B932_1057
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B932_1057
  Amino acid metabolism
   00310 Lysine degradation
    B932_1057
Enzymes [BR:goh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     B932_1057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1066235..1067332)
Genome map
AA seq 365 aa AA seqDB search
MAVEIRVPALGESLTTATVARWLKQAGDYVQHDETVVELETDKVSVEVTAPSAGRLENCI
PLGTEVEIGGLLGQIDETAEAPVAAAAPVVPPVEVARPDPVAPVVEPPPAPKPGPSPTFA
EPQVSTVSGIDDPRERRVPMSRLRQTIARNLKAAQNTAAILTTFNEIDMSAAKALRAEYR
DEFEKKHDGARLGFMSFFARAVVGALRDYPALNAQIEGDEIVYRDFVNLGIAVGTERGLV
VPVLHDADQMSFAELERRIADYGKRARMGSLKLDELSHGSFSITNGGIFGSLLSTPILNT
PQSGILGMHAIQDRPVVRDGQVVVRPMMYVALSYDHRIVDGREAVSFLVRVKQLVEDPRR
LLLDL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcgaaatccgggtgccggcgctgggagaaagcctgacgaccgcgactgtcgcg
cgctggctgaagcaggcgggcgattacgttcagcatgatgaaacagttgtcgaacttgag
acggacaaggtcagcgttgaagttacggcaccttcagccgggcgtctcgaaaactgcatt
ccgctcgggacagaagtggaaatcggcggtctcctggggcaaatcgacgaaacggctgaa
gctccggttgcggccgcagcccctgttgttccgcctgtagaggttgcacgtcctgatcct
gttgcgcctgttgttgagccaccgcccgcaccaaaacctggtcccagcccgacattcgcc
gagccccaggtctccacggtttcgggcattgatgatcccagggaacgtcgcgttccgatg
tcgcgactgcggcaaacgatcgcacggaatttgaaagcggcacagaacactgcggcgatc
ctgacgacgttcaatgaaattgatatgtcggcggccaaggctctgcgcgccgaatatcgg
gatgagtttgaaaagaagcatgatggggcccggctgggcttcatgtccttttttgccaga
gctgttgtcggtgcgcttcgcgattatcctgccctgaatgcccagatcgaaggggatgaa
atcgtttatcgggatttcgttaatctcggaattgcggttggtaccgagcgggggctggtt
gttcctgtccttcatgatgccgatcagatgagttttgccgagttggagcgtcgtattgcg
gactatggcaaacgcgcccggatggggtctctcaaactggacgaactgtcacacggcagt
ttctcgatcacgaatggtggcattttcgggtcgcttctttcgacgcccatcctgaacacg
ccgcagtcgggtattctgggcatgcatgccattcaggatcgccctgttgtgcgtgacggg
caggtggttgtccgtcccatgatgtatgttgcattgtcttacgaccatcgcattgtagac
gggcgggaagccgtcagcttccttgttcgggtcaagcagcttgttgaggatccgcgaaga
cttcttcttgatctctga

DBGET integrated database retrieval system