KEGG   Gluconobacter oxydans H24: B932_1057Help
Entry
B932_1057         CDS       T02348                                 

Definition
dihydrolipoamide succinyl transferase (E2) of 2-oxoglutarate dehydrogenase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
goh  Gluconobacter oxydans H24
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:goh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B932_1057
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B932_1057
  Amino acid metabolism
   00310 Lysine degradation
    B932_1057
Enzymes [BR:goh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     B932_1057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1066235..1067332)
Genome map
AA seq 365 aa AA seqDB search
MAVEIRVPALGESLTTATVARWLKQAGDYVQHDETVVELETDKVSVEVTAPSAGRLENCI
PLGTEVEIGGLLGQIDETAEAPVAAAAPVVPPVEVARPDPVAPVVEPPPAPKPGPSPTFA
EPQVSTVSGIDDPRERRVPMSRLRQTIARNLKAAQNTAAILTTFNEIDMSAAKALRAEYR
DEFEKKHDGARLGFMSFFARAVVGALRDYPALNAQIEGDEIVYRDFVNLGIAVGTERGLV
VPVLHDADQMSFAELERRIADYGKRARMGSLKLDELSHGSFSITNGGIFGSLLSTPILNT
PQSGILGMHAIQDRPVVRDGQVVVRPMMYVALSYDHRIVDGREAVSFLVRVKQLVEDPRR
LLLDL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcgaaatccgggtgccggcgctgggagaaagcctgacgaccgcgactgtcgcg
cgctggctgaagcaggcgggcgattacgttcagcatgatgaaacagttgtcgaacttgag
acggacaaggtcagcgttgaagttacggcaccttcagccgggcgtctcgaaaactgcatt
ccgctcgggacagaagtggaaatcggcggtctcctggggcaaatcgacgaaacggctgaa
gctccggttgcggccgcagcccctgttgttccgcctgtagaggttgcacgtcctgatcct
gttgcgcctgttgttgagccaccgcccgcaccaaaacctggtcccagcccgacattcgcc
gagccccaggtctccacggtttcgggcattgatgatcccagggaacgtcgcgttccgatg
tcgcgactgcggcaaacgatcgcacggaatttgaaagcggcacagaacactgcggcgatc
ctgacgacgttcaatgaaattgatatgtcggcggccaaggctctgcgcgccgaatatcgg
gatgagtttgaaaagaagcatgatggggcccggctgggcttcatgtccttttttgccaga
gctgttgtcggtgcgcttcgcgattatcctgccctgaatgcccagatcgaaggggatgaa
atcgtttatcgggatttcgttaatctcggaattgcggttggtaccgagcgggggctggtt
gttcctgtccttcatgatgccgatcagatgagttttgccgagttggagcgtcgtattgcg
gactatggcaaacgcgcccggatggggtctctcaaactggacgaactgtcacacggcagt
ttctcgatcacgaatggtggcattttcgggtcgcttctttcgacgcccatcctgaacacg
ccgcagtcgggtattctgggcatgcatgccattcaggatcgccctgttgtgcgtgacggg
caggtggttgtccgtcccatgatgtatgttgcattgtcttacgaccatcgcattgtagac
gggcgggaagccgtcagcttccttgttcgggtcaagcagcttgttgaggatccgcgaaga
cttcttcttgatctctga

DBGET integrated database retrieval system